5CHV: USP18-ISG15 complex

Crystal structure of USP18-ISG15 complex. Determined by X-ray diffraction at 3.0 Å resolution. Released 28 Sept 2016.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Mus musculus
Chains: 4
Atoms: 7,358
Mol. weight: 109.81 kDa
Ligands: ZN
Released: 28 Sept 2016

Explore 5CHV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CHV contains 44 α-helices and 78 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	53-54	2	1
α-helix	61-71	11
α-helix	74-81	8
α-helix	83-86	4
α-helix	89-92	4
α-helix	96-109	14
β-strand	114-115	2	1
α-helix	118-125	8
β-strand	136	1	2
α-helix	137-151	15
α-helix	155-165	11
β-strand	167-175	9	3
β-strand	181-188	8	3
β-strand	191-193	3	4
β-strand	196	1	5
α-helix	201	1
β-strand	202	1	5
α-helix	203	1
β-strand	205	1	6
α-helix	206-214	9
β-strand	217-218	2	3
α-helix	219-220	2
α-helix	224	1
β-strand	225	1	7
α-helix	226	1
β-strand	232	1	7
β-strand	235-243	9	3
β-strand	247-252	6	4
β-strand	255-258	4	8
β-strand	259	1	9
β-strand	261-264	4	8
β-strand	270	1	6
β-strand	274-276	3	4
β-strand	297-309	13	4
β-strand	312-320	9	4
β-strand	327-331	5	4
β-strand	334-338	5	4
α-helix	340-343	4
α-helix	344-347	4
β-strand	357-365	9	4

Chain B: 14 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	53-54	2	14
α-helix	61-71	11
α-helix	74-81	8
α-helix	84-86	3
α-helix	96-109	14
β-strand	114-115	2	14
α-helix	118-125	8
β-strand	136	1	15
α-helix	137-151	15
α-helix	155-165	11
β-strand	167-175	9	16
β-strand	181-188	8	16
β-strand	190-193	4	17
β-strand	196	1	18
α-helix	201	1
β-strand	202	1	18
α-helix	203	1
β-strand	205	1	19
α-helix	206-214	9
β-strand	217-218	2	16
α-helix	219-220	2
α-helix	224-226	3
β-strand	235-243	9	16
β-strand	247-252	6	17
β-strand	255-258	4	20
β-strand	259	1	21
β-strand	261-264	4	20
β-strand	270	1	19
β-strand	274-276	3	17
β-strand	297-308	12	17
β-strand	313-320	8	17
β-strand	327-331	5	17
β-strand	334-338	5	17
α-helix	340-343	4
α-helix	344-347	4
β-strand	357-365	9	17

Chain C: 8 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	10
β-strand	14-19	6	10
β-strand	24	1	11
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-46	4	10
β-strand	51	1	10
α-helix	52-53	2
β-strand	57	1	11
α-helix	59-61	3
β-strand	68-73	6	10
β-strand	79-85	7	12
β-strand	91-97	7	12
β-strand	101	1	13
α-helix	102-113	12
β-strand	115	1	9
α-helix	117-119	3
β-strand	121-124	4	12
β-strand	127-128	2	12
α-helix	129	1
β-strand	134	1	13
α-helix	135-138	4
β-strand	145-149	5	12
β-strand	153	1	2

Chain D: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	22
β-strand	15-19	5	22
β-strand	24	1	23
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-44	2	24
β-strand	57	1	23
β-strand	68-71	4	22
β-strand	72-73	2	24
β-strand	80-85	6	25
β-strand	91-96	6	25
β-strand	101	1	26
α-helix	102-113	12
β-strand	115	1	21
α-helix	117-119	3
β-strand	121-124	4	25
β-strand	127-128	2	25
α-helix	129	1
β-strand	134	1	26
α-helix	135-138	4
β-strand	145-149	5	25
β-strand	153	1	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubl carboxyl-terminal hydrolase 18	A, B	protein	323	Mus musculus	Q9WTV6 (AlphaFold model)
Ubiquitin-like protein ISG15	C, D	protein	155	Mus musculus	Q64339 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5CHV_1 Ubl carboxyl-terminal hydrolase 18 (chains A, B)
DSPHGLVGLHNIGQTCCLNSLLQVFMMNMDFRMILKRITVPRSAEERKRSVPFQLLLLLE
KMQDSRQKAVLPTELVQCLQKYNVPLFVQHDAAQLYLTIWNLTKDQITDTDLTERLQGLF
TIWTQESLICVGCTAESSRRSKLLTLSLPLFDKDAKPLKTLEDALRCFVQPKELASSDMC
CESCGEKTPWKQVLKLTHLPQTLTIHLMRFSARNSRTEKICHSVNFPQSLDFSQVLPTEE
DLGDTKEQSEIHYELFAVIAHVGMADFGHYCAYIRNPVDGKWFCFNDSHVCWVTWKDVQC
TYGNHRYRWRETAYLLVYTKTGS

Sequence of entity 2 (C, D), FASTA

>5CHV_2 Ubiquitin-like protein ISG15 (chains C, D)
MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSS
LGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQF
WLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGX

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (CL, SO4) are not listed.

Primary citation

Structural basis of the specificity of USP18 toward ISG15. Basters, A., Geurink, P.P., Rocker, A. et al. Nat Struct Mol Biol (2017) 24:270-278. DOI 10.1038/nsmb.3371 · PubMed

Other PDB entries of the same protein (UniProt Q9WTV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CHT 2.8 Å, Crystal structure of USP18

Browse structure collections

About this viewer

MolViewer shows 5CHV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.