Structural basis of the recognition of H3K36me3 by DNMT3B PWWP domain. Determined by X-ray diffraction at 2.24 Å resolution. Released 30 Mar 2016.
Explore 5CIU in 3D Show helices and sheets RCSB PDB PDBe
5CIU contains 15 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 228-231 | 4 | 1 |
| β-strand | 239-244 | 6 | 1 |
| α-helix | 246-248 | 3 | |
| α-helix | 253-255 | 3 | |
| β-strand | 258-263 | 6 | 1 |
| β-strand | 269-273 | 5 | 1 |
| α-helix | 274-276 | 3 | |
| β-strand | 277-279 | 3 | 1 |
| α-helix | 289-294 | 6 | |
| α-helix | 296-313 | 18 | |
| α-helix | 329-337 | 9 | |
| α-helix | 345-348 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 228-231 | 4 | 2 |
| β-strand | 239-244 | 6 | 2 |
| α-helix | 246-248 | 3 | |
| α-helix | 253-255 | 3 | |
| β-strand | 258-263 | 6 | 2 |
| β-strand | 269-273 | 5 | 2 |
| α-helix | 274-276 | 3 | |
| β-strand | 278-279 | 2 | 2 |
| α-helix | 283-286 | 4 | |
| α-helix | 296-313 | 18 | |
| α-helix | 330-337 | 8 | |
| α-helix | 345-347 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 35 | 1 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 35 | 1 | 1 |
| α-helix | 36-37 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA (cytosine-5)-methyltransferase 3B | A, B | protein | 150 | Homo sapiens | Q9UBC3 (AlphaFold model) |
| Histone H3.2 | C, D | protein | 15 | Homo sapiens | Q71DI3 (AlphaFold model) |
>5CIU_1 DNA (cytosine-5)-methyltransferase 3B (chains A, B) EADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFG DGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSL EDQLKPMLEWAHGGFKPTGIEGLKPNNTQP
>5CIU_2 Histone H3.2 (chains C, D) SAPATGGVKKPHRYR
Structural basis for recognition of histone H3K36me3 nucleosome by human de novo DNA methyltransferases 3A and 3B. Rondelet, G., Dal Maso, T., Willems, L. et al. J Struct Biol (2016) 194:357-367. DOI 10.1016/j.jsb.2016.03.013 · PubMed
Other PDB entries of the same protein (UniProt Q9UBC3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CIU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.