5COL: 50S ribosomal protein L11

Ribosomal protein L11 from methanococcus jannaschii. Determined by X-ray diffraction at 2.25 Å resolution. Released 17 Aug 2016.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Methanocaldococcus jannaschii
Chains: 2
Atoms: 2,385
Mol. weight: 35.51 kDa
Ligands: CIT
Released: 17 Aug 2016

Explore 5COL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5COL contains 16 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	1
α-helix	20-24	5
α-helix	31-41	11
α-helix	43-45	3
β-strand	49-57	9	1
β-strand	63-67	5	1
α-helix	72-80	9
β-strand	95-97	3	2
α-helix	99-112	14
α-helix	118-131	14
β-strand	134-136	3	2
β-strand	139	1	2
α-helix	141-150	10

Chain B: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	3
α-helix	20-24	5
α-helix	25-27	3
α-helix	31-41	11
α-helix	43-45	3
β-strand	49-57	9	3
β-strand	63-67	5	3
α-helix	72-79	8
β-strand	95-97	3	4
α-helix	99-111	13
α-helix	118-132	15
β-strand	134-136	3	4
β-strand	139	1	4
α-helix	141-149	9
α-helix	154-156	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
50S ribosomal protein L11	A, B	protein	161	Methanocaldococcus jannaschii	P54030 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5COL_1 50S ribosomal protein L11 (chains A, B)
MAKEVVEVLVTGGRATAGPPLGPAIGPLGVNVMQVVKEINEKTKDYEGMQVPVKVIVDTE
TRKFEIEVGIPPTTALIKKELGIETAAHEPRHEVVGNLTLEQVIKIAKMKKDAMLSYTLK
NAVKEVLGTCGSMGVTVEGKDPKEVQKEIDAGVYDEYFKEE

Ligands and cofactors

ID	Name	Formula	Copies
CIT	Citric acid	C6 H8 O7	1

Water and common crystallization additives (PEG, PGE, CL) are not listed.

Primary citation

CRYSTAL STRUCTURE OF RIBOSOMAL PROTEIN L11 FROM METHANOCOCCUS JANNASCHII. Gabdulkhakov, A.G. To be published.

Other PDB entries of the same protein (UniProt P54030 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D8H 2.8 Å, Crystal structure of the base of the ribosomal P stalk from methanococcus jannaschii…
5DAR 2.9 Å, Crystal structure of the base of the ribosomal P stalk from methanococcus jannaschii

Browse structure collections

About this viewer

MolViewer shows 5COL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.