Compensation of the effect of isoleucine to alanine mutation by designed inhibition in the InhA enzyme. Determined by X-ray diffraction at 3.41 Å resolution. Released 12 Aug 2015.
Explore 5CPF in 3D Show helices and sheets RCSB PDB PDBe
5CPF contains 54 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-12 | 4 | 1 |
| α-helix | 21-31 | 11 | |
| β-strand | 35-40 | 6 | 1 |
| α-helix | 44-51 | 8 | |
| β-strand | 60-62 | 3 | 1 |
| α-helix | 68-82 | 15 | |
| β-strand | 88-93 | 6 | 1 |
| α-helix | 113-120 | 8 | |
| α-helix | 121-125 | 5 | |
| α-helix | 126-134 | 9 | |
| α-helix | 135-137 | 3 | |
| β-strand | 138-148 | 11 | 1 |
| β-strand | 154 | 1 | 2 |
| α-helix | 159-181 | 23 | |
| β-strand | 185-191 | 7 | 1 |
| α-helix | 198-202 | 5 | |
| α-helix | 209-225 | 17 | |
| α-helix | 236-246 | 11 | |
| β-strand | 257-260 | 4 | 1 |
| β-strand | 267 | 1 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-12 | 6 | 4 |
| α-helix | 21-31 | 11 | |
| β-strand | 34-40 | 7 | 4 |
| α-helix | 44-51 | 8 | |
| β-strand | 60-62 | 3 | 4 |
| α-helix | 68-82 | 15 | |
| β-strand | 88-93 | 6 | 4 |
| α-helix | 100-102 | 3 | |
| α-helix | 108-110 | 3 | |
| α-helix | 113-120 | 8 | |
| α-helix | 121-125 | 5 | |
| α-helix | 126-134 | 9 | |
| α-helix | 135-137 | 3 | |
| β-strand | 138-148 | 11 | 4 |
| β-strand | 154 | 1 | 5 |
| α-helix | 159-181 | 23 | |
| β-strand | 185-191 | 7 | 4 |
| α-helix | 197-205 | 9 | |
| α-helix | 208-211 | 4 | |
| α-helix | 213-216 | 4 | |
| α-helix | 220-224 | 5 | |
| α-helix | 236-246 | 11 | |
| β-strand | 256-260 | 5 | 4 |
| β-strand | 267 | 1 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-12 | 4 | 7 |
| α-helix | 21-31 | 11 | |
| α-helix | 34 | 1 | |
| β-strand | 35-40 | 6 | 7 |
| α-helix | 44-51 | 8 | |
| β-strand | 60-62 | 3 | 7 |
| α-helix | 68-82 | 15 | |
| β-strand | 88 | 1 | 8 |
| β-strand | 91-93 | 3 | 7 |
| α-helix | 113-120 | 8 | |
| α-helix | 121-125 | 5 | |
| α-helix | 126-134 | 9 | |
| α-helix | 135-137 | 3 | |
| β-strand | 138 | 1 | 8 |
| β-strand | 143-148 | 6 | 7 |
| β-strand | 154 | 1 | 3 |
| α-helix | 159-182 | 24 | |
| β-strand | 185-191 | 7 | 7 |
| α-helix | 199-202 | 4 | |
| α-helix | 209-225 | 17 | |
| α-helix | 236-246 | 11 | |
| β-strand | 256-260 | 5 | 7 |
| α-helix | 264-266 | 3 | |
| β-strand | 267 | 1 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 9 |
| α-helix | 21-31 | 11 | |
| β-strand | 35-40 | 6 | 9 |
| α-helix | 44-51 | 8 | |
| β-strand | 60-62 | 3 | 9 |
| α-helix | 68-82 | 15 | |
| β-strand | 88-93 | 6 | 9 |
| α-helix | 100-102 | 3 | |
| α-helix | 108-110 | 3 | |
| α-helix | 113-123 | 11 | |
| α-helix | 126-134 | 9 | |
| α-helix | 135-137 | 3 | |
| β-strand | 138-148 | 11 | 9 |
| β-strand | 154 | 1 | 6 |
| α-helix | 159-178 | 20 | |
| β-strand | 185-191 | 7 | 9 |
| α-helix | 197-198 | 2 | |
| α-helix | 199-203 | 5 | |
| α-helix | 208-210 | 3 | |
| α-helix | 213-223 | 11 | |
| α-helix | 236-246 | 11 | |
| β-strand | 257-260 | 4 | 9 |
| α-helix | 264-266 | 3 | |
| β-strand | 267 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Enoyl-[acyl-carrier-protein] reductase [NADH] | A, B, C, D | protein | 289 | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) | P9WGR0 (AlphaFold model) |
>5CPF_1 Enoyl-[acyl-carrier-protein] reductase [NADH] (chains A, B, C, D) MGSSHHHHHHSSGLVPRGSHMTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTG FDRLRLIQRITDRLPAKAPLLELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQ TGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNW MTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQAQLLEE GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL
| ID | Name | Formula | Copies |
|---|---|---|---|
| 53K | 2-(2-methylphenoxy)-5-[(4-phenyl-1H-1,2,3-triazol-1-yl)methyl]phenol | C22 H19 N3 O2 | 4 |
| NAD | Nicotinamide-adenine-dinucleotide | C21 H27 N7 O14 P2 | 4 |
Rational Modulation of the Induced-Fit Conformational Change for Slow-Onset Inhibition in Mycobacterium tuberculosis InhA. Lai, C.T., Li, H.J., Yu, W. et al. Biochemistry (2015) 54:4683-4691. DOI 10.1021/acs.biochem.5b00284 · PubMed
Other PDB entries of the same protein (UniProt P9WGR0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CPF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.