5CQ8: PDB entry 5CQ8

Crystal structure of the bromodomain of bromodomain adjacent to zinc finger domain protein 2B (BAZ2B) in complex with 4'-Hydroxyacetophenone (SGC - Diamond I04-1 fragment screening). Determined by X-ray diffraction at 1.65 Å resolution. Released 9 Sept 2015.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,139
Mol. weight: 14.32 kDa
Ligands: AC6
Released: 9 Sept 2015

Explore 5CQ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CQ8 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	1860-1862	3
α-helix	1869-1881	13
α-helix	1884-1889	6
α-helix	1901-1904	4
α-helix	1911-1919	9
α-helix	1926-1943	18
α-helix	1949-1969	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain adjacent to zinc finger domain protein 2B	A	protein	120	Homo sapiens	Q9UIF8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5CQ8_1 Bromodomain adjacent to zinc finger domain protein 2B (chains A)
YFQSMSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFS
TIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFKVS

Ligands and cofactors

ID	Name	Formula	Copies
AC6	P-hydroxyacetophenone	C8 H8 O2	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Crystal structure of the second bromodomain of bromodomain adjancent to zinc finger domain protein 2B (BAZ2B) in complex with 4'-Hydroxyacetophenone (SGC - Diamond I04-1 fragment screening). Bradley, A., Pearce, N., Krojer, T. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UIF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5PG1 1.49 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PFM 1.54 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PGB 1.57 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PGJ 1.58 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PGA 1.59 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
4QC3 1.6 Å, Crystal structure of human BAZ2B bromodomain in complex with a diacetylated histone 4…
4QF3 1.6 Å, Crystal structure of human BAZ2B PHD zinc finger in the free form
5PGC 1.61 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PG9 1.62 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PDG 1.63 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PFW 1.64 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PGS 1.64 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…

Browse structure collections

About this viewer

MolViewer shows 5CQ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.