5CRC: SdeA DUB Domain

Structure of the SdeA DUB Domain. Determined by X-ray diffraction at 2.85 Å resolution. Released 25 Nov 2015.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Legionella pneumophila
Chains: 2
Atoms: 2,267
Mol. weight: 42.7 kDa
Released: 25 Nov 2015

Explore 5CRC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CRC contains 15 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	14-20	7
α-helix	27-28	2
β-strand	30-33	4	1
β-strand	36-37	2	1
α-helix	42-47	6
β-strand	49	1	2
β-strand	52-56	5	1
β-strand	64-66	3	1
β-strand	67-70	4	2
β-strand	75-79	5	2
α-helix	91-94	4
α-helix	95-97	3
β-strand	103-106	4	2
α-helix	116-124	9
α-helix	126-130	5
α-helix	141-155	15

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
α-helix	12-21	10
β-strand	30-33	4	3
β-strand	36-38	3	3
β-strand	49-56	8	3
β-strand	64-70	7	3
β-strand	75-79	5	3
α-helix	84-87	4
α-helix	91-95	5
β-strand	103-106	4	3
α-helix	117-132	16
α-helix	141-146	6
α-helix	148-154	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SdeA	A, B	protein	193	Legionella pneumophila	Q6RCR0

Sequence of entity 1 (A, B), FASTA

>5CRC_1 SdeA (chains A, B)
MPKYVEGVELTQEGMHAIFARMGYGDITSGSIYNGVPTIDTGALNRQGFMPVLTGVGPHR
DSGHWIMLIKGPGNQYYLFDPLGKTSGEGYQNILAAQLPMGSTLSVIPNGSGLNMGLCGY
WVASAGLRAHQALNQHNPPTLLNVGQTITNEMRNELDHDGYRKITGWLRAVADEFPEGDP
QLDGKALRENTEK

Primary citation

Structural basis of substrate recognition by a bacterial deubiquitinase important for dynamics of phagosome ubiquitination. Sheedlo, M.J., Qiu, J., Tan, Y. et al. Proc Natl Acad Sci U S A (2015) 112:15090-15095. DOI 10.1073/pnas.1514568112 · PubMed

Other PDB entries of the same protein (UniProt Q6RCR0), best resolution first:

5CRB 2.0 Å, Crystal Structure of SdeA DUB
5CRA 2.64 Å, Structure of the SdeA DUB Domain
5YIK 3.1 Å, Structure of a Legionella effector with its substrate
5YIJ 3.18 Å, Structure of a Legionella effector with substrates
5YIM 3.39 Å, Structure of a Legionella effector

Browse structure collections

About this viewer

MolViewer shows 5CRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.