Crystal structure of LegAS4. Determined by X-ray diffraction at 2.2 Å resolution. Released 23 Sept 2015.
Explore 5CZY in 3D Show helices and sheets RCSB PDB PDBe
5CZY contains 29 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 89-96 | 8 | |
| α-helix | 103-105 | 3 | |
| β-strand | 106 | 1 | 1 |
| α-helix | 114-116 | 3 | |
| β-strand | 117-121 | 5 | 2 |
| α-helix | 123-128 | 6 | |
| β-strand | 131-135 | 5 | 2 |
| β-strand | 139 | 1 | 3 |
| β-strand | 144-147 | 4 | 4 |
| β-strand | 151-154 | 4 | 5 |
| α-helix | 155-164 | 10 | |
| β-strand | 173-176 | 4 | 5 |
| β-strand | 179-182 | 4 | 5 |
| β-strand | 187 | 1 | 1 |
| α-helix | 189-192 | 4 | |
| β-strand | 194-195 | 2 | 4 |
| β-strand | 202-209 | 8 | 4 |
| β-strand | 212-219 | 8 | 4 |
| β-strand | 223 | 1 | 3 |
| α-helix | 227 | 1 | |
| β-strand | 228 | 1 | 2 |
| α-helix | 229 | 1 | |
| β-strand | 230-231 | 2 | 4 |
| α-helix | 240-243 | 4 | |
| α-helix | 256-262 | 7 | |
| α-helix | 264-266 | 3 | |
| β-strand | 268-271 | 4 | 6 |
| β-strand | 276 | 1 | 7 |
| α-helix | 277-279 | 3 | |
| β-strand | 281 | 1 | 7 |
| β-strand | 286-289 | 4 | 6 |
| α-helix | 291-298 | 8 | |
| α-helix | 310-313 | 4 | |
| α-helix | 315-316 | 2 | |
| β-strand | 317 | 1 | 8 |
| β-strand | 318-319 | 2 | 6 |
| β-strand | 320 | 1 | 9 |
| β-strand | 326 | 1 | 9 |
| α-helix | 327-328 | 2 | |
| β-strand | 335 | 1 | 8 |
| α-helix | 337-344 | 8 | |
| α-helix | 347-355 | 9 | |
| α-helix | 371-381 | 11 | |
| α-helix | 385-397 | 13 | |
| β-strand | 405 | 1 | 10 |
| β-strand | 411 | 1 | 10 |
| α-helix | 412-419 | 8 | |
| α-helix | 422-434 | 13 | |
| α-helix | 440-444 | 5 | |
| α-helix | 454-460 | 7 | |
| α-helix | 464-473 | 10 | |
| α-helix | 477-482 | 6 | |
| α-helix | 487-500 | 14 | |
| α-helix | 508-518 | 11 | |
| α-helix | 525-530 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Legionella effector LegAS4 | A | protein | 483 | Legionella pneumophila subsp. pneumophila str. Philadelphia 1 | Q5ZUS4 (AlphaFold model) |
>5CZY_1 Legionella effector LegAS4 (chains A) MTHLPGNIYTLFTPVNGPKSKDEWIDTSKIMLDLHIDNMSSSDYIPSAIDRTDLVMVQSV HLLRKTGGRGLFAREDIPKGTCIGIYTGEVYSEQEFEQYLKEHVGSDKSYAMYVGGRVID AARKGNLTRYINFSDSQDNAEFVETTLNRKKVAKVITTKNIKAGQQLLINYNTYEEQASR YYYFLNPGDGWLSAQEFYQTYQSQYRLEQMPYNLEGFDLKAGDRVLMTQIGRIILANYSL AKEQELNASDIDLPFLKVGSDEKILDFDEADTFTPLMAACYLGQVENVKWLIEHGANIDQ QQSHSGHCPLSLTLKGYSLAKDTQKYIDIIQLLIKNQVNLLVHDRSDKTFLHNAALVLNN LDFQSVVKFLIGQNPIDINEYFTYIDENDFDIVMHCYNNKLFDKALVLLAFYPDYFKRNY MSDNEGHNQFNINAFRKAIKDFNSNERSILLMQLRESGLHLPEDLLEQLGIMDSSITLES KFF
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAM | S-adenosylmethionine | C15 H22 N6 O5 S | 1 |
Water and common crystallization additives (GOL) are not listed.
Crystal structure of Legionella pneumophila type IV secretion system effector LegAS4. Son, J., Jo, C.H., Murugan, R.N. et al. Biochem Biophys Res Commun (2015) 465:817-824. DOI 10.1016/j.bbrc.2015.08.094 · PubMed
Other PDB entries of the same protein (UniProt Q5ZUS4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CZY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.