5D0I: RING finger protein 165

Structure of RING finger protein 165. Determined by X-ray diffraction at 1.9 Å resolution. Released 9 Dec 2015.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 963
Mol. weight: 22.39 kDa
Ligands: ZN
Released: 9 Dec 2015

Explore 5D0I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5D0I contains 7 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	261-264	4
β-strand	266-269	4	1
β-strand	293	1	2
α-helix	299	1
β-strand	300	1	2
α-helix	301	1
β-strand	306-309	4	1
β-strand	315-317	3	1
α-helix	318-328	11
β-strand	330	1	3
β-strand	337	1	3

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	293	1	4
β-strand	300	1	4
β-strand	307-309	3	5
β-strand	315-317	3	5
α-helix	318-327	10
β-strand	330	1	6
α-helix	336	1
β-strand	337	1	6
α-helix	338-339	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RING finger protein 165	A, B	protein	97	Homo sapiens	Q6ZSG1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5D0I_1 RING finger protein 165 (chains A, B)
GPLGSGAVQNTIERFTFPHKYKKRRPQDGKGKKDEGEESDTDEKCTICLSMLEDGEDVRR
LPCMHLFHQLCVDQWLAMSKKCPICRVDIETQLGADS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Water and common crystallization additives (SO4) are not listed.

Primary citation

Secondary ubiquitin-RING docking enhances Arkadia and Ark2C E3 ligase activity. Wright, J.D., Mace, P.D., Day, C.L. Nat Struct Mol Biol (2016) 23:45-52. DOI 10.1038/nsmb.3142 · PubMed

Other PDB entries of the same protein (UniProt Q6ZSG1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D0M 1.91 Å, Structure of UbE2D2:RNF165:Ub complex
5ULH 1.95 Å, Structure of RNF165 in complex with a UbcH5b~Ub conjugate
9N1F 2.1 Å, Crystal Structure of the Ark2C-Ubc13~Ub-Mms2 complex
5ULK 2.38 Å, Crystal Structure of RNF165 in complex with a UbcH5b~Ub conjugate
7R70 2.5 Å, Crystal Structure of the UbArk2C fusion protein
5D0K 2.65 Å, Structure of UbE2D2:RNF165:Ub complex
7R71 2.8 Å, Crystal Structure of the UbArk2C-UbcH5b~Ub complex
9QAL Solution NMR structure of Arkadia 2 RING domain

Browse structure collections

About this viewer

MolViewer shows 5D0I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.