Anthrax toxin lethal factor with hydroxamic acid inhibitor. Determined by X-ray diffraction at 2.1 Å resolution. Released 11 Nov 2015.
Explore 5D1S in 3D Show helices and sheets RCSB PDB PDBe
5D1S contains 30 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 267-277 | 11 | |
| α-helix | 279-283 | 5 | |
| α-helix | 287-297 | 11 | |
| β-strand | 300 | 1 | 1 |
| α-helix | 301-303 | 3 | |
| α-helix | 304-309 | 6 | |
| α-helix | 313-320 | 8 | |
| α-helix | 332-346 | 15 | |
| α-helix | 351-356 | 6 | |
| α-helix | 370-379 | 10 | |
| α-helix | 380-382 | 3 | |
| β-strand | 386 | 1 | 1 |
| α-helix | 388-395 | 8 | |
| α-helix | 406-422 | 17 | |
| β-strand | 426 | 1 | 2 |
| α-helix | 428-431 | 4 | |
| β-strand | 437-441 | 5 | 3 |
| α-helix | 443-445 | 3 | |
| α-helix | 448-452 | 5 | |
| β-strand | 455 | 1 | 4 |
| β-strand | 463 | 1 | 4 |
| α-helix | 465-474 | 10 | |
| β-strand | 477-480 | 4 | 3 |
| β-strand | 485-487 | 3 | 3 |
| β-strand | 499-504 | 6 | 3 |
| β-strand | 510 | 1 | 2 |
| β-strand | 511-514 | 4 | 3 |
| β-strand | 518-521 | 4 | 3 |
| α-helix | 522 | 1 | |
| β-strand | 525-536 | 12 | 3 |
| β-strand | 541-550 | 10 | 3 |
| α-helix | 552-574 | 23 | |
| β-strand | 583-586 | 4 | 5 |
| α-helix | 592-609 | 18 | |
| α-helix | 612-624 | 13 | |
| β-strand | 629-632 | 4 | 5 |
| α-helix | 636-638 | 3 | |
| α-helix | 640-643 | 4 | |
| α-helix | 649-651 | 3 | |
| β-strand | 657-660 | 4 | 5 |
| β-strand | 665-669 | 5 | 5 |
| α-helix | 680-700 | 21 | |
| α-helix | 708-710 | 3 | |
| α-helix | 712-721 | 10 | |
| α-helix | 728-730 | 3 | |
| α-helix | 733-744 | 12 | |
| α-helix | 749-758 | 10 | |
| α-helix | 760-775 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lethal factor | A | protein | 519 | Bacillus anthracis | P15917 (AlphaFold model) |
>5D1S_1 Lethal factor (chains A) SNALSRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKR IQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKL DIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENM NINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKW RIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQE AQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNY LVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDS EGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAF RLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINSLVPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
| 56Q | N~2~-[(4-fluoro-3-methylphenyl)sulfonyl]-N-hydroxy-N~2~-methyl-D-alaninamide | C11 H15 F N2 O4 S | 1 |
Probing the S2' Subsite of the Anthrax Toxin Lethal Factor Using Novel N-Alkylated Hydroxamates. Kurbanov, E.K., Chiu, T.L., Solberg, J. et al. J Med Chem (2015) 58:8723-8733. DOI 10.1021/acs.jmedchem.5b01446 · PubMed
Other PDB entries of the same protein (UniProt P15917 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5D1S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.