5DSY: Constitutively active PARP-2

Crystal structure of constitutively active PARP-2. Determined by X-ray diffraction at 2.7 Å resolution. Released 27 Jul 2016.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,087
Mol. weight: 128.85 kDa
Ligands: UHB
Released: 27 Jul 2016

Explore 5DSY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DSY contains 49 α-helices and 59 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	223-232	10
α-helix	344-350	7
β-strand	354-358	5	1
α-helix	364-375	12
β-strand	384-396	13	1
α-helix	399-402	4
β-strand	410-416	7	1
α-helix	419-421	3
α-helix	422-428	7
α-helix	430-434	5
β-strand	448-450	3	2
β-strand	451	1	1
α-helix	454-458	5
β-strand	469-478	10	1
β-strand	482-485	4	2
α-helix	494-496	3
β-strand	501-504	4	2
β-strand	506-510	5	3
α-helix	512-514	3
β-strand	516-518	3	1
β-strand	521-523	3	1
β-strand	528-530	3	3
α-helix	539-540	2
β-strand	541-543	3	3
β-strand	545-548	4	2
α-helix	551-553	3
β-strand	554-566	13	1

Chain B: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	223-232	10
α-helix	344-350	7
β-strand	354-358	5	4
α-helix	364-375	12
β-strand	384-396	13	4
α-helix	399-402	4
β-strand	410-416	7	4
α-helix	419-421	3
α-helix	422-428	7
α-helix	432-434	3
β-strand	448-450	3	5
β-strand	451	1	4
α-helix	454-458	5
α-helix	459-461	3
β-strand	469-478	10	4
β-strand	482-485	4	5
α-helix	494-496	3
β-strand	501-504	4	5
β-strand	508-510	3	6
α-helix	512-514	3
β-strand	516-518	3	4
β-strand	521-523	3	4
β-strand	528-530	3	6
β-strand	543	1	6
β-strand	545-548	4	5
α-helix	551-553	3
β-strand	554-566	13	4

Chain C: 13 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	223-233	11
α-helix	344-350	7
β-strand	354-358	5	7
α-helix	364-375	12
β-strand	384-396	13	7
α-helix	399-402	4
β-strand	410-416	7	7
α-helix	419-421	3
α-helix	422-428	7
α-helix	430-432	3
α-helix	434	1
β-strand	448-450	3	8
β-strand	451	1	7
α-helix	454-458	5
α-helix	459-461	3
β-strand	469-478	10	7
β-strand	482-485	4	8
α-helix	490-496	7
β-strand	501-504	4	8
β-strand	506-510	5	6
α-helix	512-514	3
β-strand	516-518	3	7
β-strand	521-523	3	7
β-strand	528-530	3	6
β-strand	541-543	3	6
β-strand	545-548	4	8
α-helix	551-553	3
β-strand	554-566	13	7

Chain D: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	223-232	10
α-helix	344-350	7
β-strand	354-359	6	9
α-helix	364-375	12
β-strand	384-396	13	9
α-helix	399-402	4
β-strand	410-416	7	9
α-helix	419-421	3
α-helix	422-428	7
α-helix	430-434	5
β-strand	448-451	4	9
α-helix	454-458	5
α-helix	459-461	3
β-strand	469-478	10	9
β-strand	482-485	4	9
α-helix	494-496	3
β-strand	501-504	4	9
β-strand	506-510	5	3
α-helix	512-514	3
β-strand	516-518	3	9
β-strand	521-523	3	9
β-strand	528-530	3	3
β-strand	541-543	3	3
β-strand	545-548	4	9
α-helix	551-553	3
β-strand	554-566	13	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Poly [ADP-ribose] polymerase 2	A, B, C, D	protein	280	Homo sapiens	Q9UGN5 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5DSY_1 Poly [ADP-ribose] polymerase 2 (chains A, B, C, D)
MGSSHHHHHHSSGLVPRGSHPESQLDLRVQELIKLICNVQAMEEKTELQSPEHPLDQHYR
NLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNR
MLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTG
LLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASD
TGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNFLQLW

Ligands and cofactors

ID	Name	Formula	Copies
UHB	2-[4-[(2S,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]carbonyl…	C24 H27 N9 O6	4

Primary citation

PARP-1 Activation Requires Local Unfolding of an Autoinhibitory Domain. Dawicki-McKenna, J.M., Langelier, M.F., DeNizio, J.E. et al. Mol Cell (2015) 60:755-768. DOI 10.1016/j.molcel.2015.10.013 · PubMed

Other PDB entries of the same protein (UniProt Q9UGN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZZX 1.65 Å, Structure of PARP2 catalytic domain bound to an isoindolinone inhibitor
5D5K 1.9 Å, Crystal Structure NLS from human PARP-2 complexed with Importin alpha delta IBB
3KJD 1.95 Å, Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor…
3KCZ 2.0 Å, Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor…
7R59 2.0 Å, PARP2 catalytic domain in complex with OUL245
4TVJ 2.1 Å, Human ARTD2 (PARP2) - catalytic domain in complex with olaparib
8HKO 2.1 Å, Mutated human ADP-ribosyltransferase 2 (PARP2) catalytic domain bound to Rucaparib
9IM8 2.1 Å, Mutated ADP-ribosyltransferase 2 (PARP2) catalytic domain bound to a pyrimidine…
9ZQB 2.1 Å, Nucleosome with an SSB at SHL -2.8 in complex with human PARP2 and HPF1, Class 1
4ZZY 2.2 Å, Structure of human PARP2 catalytic domain bound to an isoindolinone inhibitor
6F1K 2.2 Å, Structure of ARTD2/PARP2 WGR domain bound to double strand DNA without 5'phosphate
8HLJ 2.24 Å, Mutated human ADP-ribosyltransferase 2 (PARP2) catalytic domain bound to Olaparib…

Browse structure collections

About this viewer

MolViewer shows 5DSY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.