5DVW: Minor nucleoprotein V30 from Zaire ebolavirus

Structure of minor nucleoprotein V30 from Zaire ebolavirus. Determined by X-ray diffraction at 1.75 Å resolution. Released 4 Nov 2015.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Zaire ebolavirus (strain Mayinga-76)
Chains: 4
Atoms: 4,477
Mol. weight: 60.69 kDa
Released: 4 Nov 2015

Explore 5DVW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DVW contains 40 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	144-155	12
α-helix	164-178	15
α-helix	183-185	3
α-helix	186-196	11
α-helix	201-203	3
α-helix	204-215	12
α-helix	221-229	9
α-helix	232-246	15
α-helix	254-257	4
α-helix	261-264	4
α-helix	265-267	3

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	144-155	12
α-helix	164-178	15
α-helix	183-185	3
α-helix	186-197	12
α-helix	201-203	3
α-helix	204-215	12
α-helix	221-229	9
α-helix	232-246	15
α-helix	254-257	4
α-helix	261-264	4
α-helix	265-267	3

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	144-155	12
α-helix	164-178	15
α-helix	183-185	3
α-helix	186-196	11
α-helix	201-203	3
α-helix	204-215	12
α-helix	221-229	9
α-helix	232-245	14
α-helix	255-264	10

Chain D: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	144-155	12
α-helix	164-178	15
α-helix	183-185	3
α-helix	186-197	12
α-helix	201-203	3
α-helix	204-215	12
α-helix	221-229	9
α-helix	232-245	14
α-helix	255-264	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Minor nucleoprotein VP30	A, B, C, D	protein	134	Zaire ebolavirus (strain Mayinga-76)	Q05323 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5DVW_1 Minor nucleoprotein VP30 (chains A, B, C, D)
QGAITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREG
LGQDQAEPVLEVYQRLHSDKGGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVV
SGLRTLVPQSDNEE

Primary citation

Structure of minor nucleoprotein V30 from Zaire ebolavirus. Clifton, M.C., Lukacs, C.M., Abendroth, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q05323 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5T3T 2.2 Å, Ebola virus VP30 CTD bound to nucleoprotein

Browse structure collections

About this viewer

MolViewer shows 5DVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.