5DXT: P110alpha with GDC-0326

p110alpha with GDC-0326. Determined by X-ray diffraction at 2.25 Å resolution. Released 27 Jan 2016.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Homo sapiens
Chains: 1
Atoms: 7,417
Mol. weight: 112.5 kDa
Ligands: 5H5
Released: 27 Jan 2016

Explore 5DXT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DXT contains 50 α-helices and 34 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 50 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	108-121	14
α-helix	126-129	4
α-helix	134-142	9
α-helix	144-155	12
α-helix	158-166	9
β-strand	171	1	1
α-helix	176-178	3
α-helix	179-182	4
β-strand	189-197	9	2
β-strand	204-212	9	2
α-helix	217-230	14
β-strand	250-254	5	2
β-strand	260	1	2
α-helix	267-269	3
β-strand	270	1	1
α-helix	271-279	9
β-strand	284-289	6	2
α-helix	290-294	5
α-helix	306-308	3
β-strand	323-326	4	3
α-helix	327-329	3
β-strand	333-342	10	4
β-strand	355-362	8	5
β-strand	365-366	2	5
β-strand	371-372	2	5
α-helix	373-375	3
β-strand	382-392	11	4
α-helix	393-395	3
β-strand	400-408	9	5
β-strand	420-428	9	5
β-strand	430	1	6
β-strand	435	1	3
β-strand	436	1	6
α-helix	437	1
β-strand	440-444	5	4
β-strand	446-447	2	5
α-helix	461	1
β-strand	462	1	5
β-strand	472-477	6	4
β-strand	482-485	4	3
α-helix	486-488	3
α-helix	489-504	16
α-helix	508-512	5
α-helix	525-535	11
α-helix	545-553	9
α-helix	555-558	4
α-helix	562-564	3
α-helix	565-571	7
α-helix	577-588	12
α-helix	590-592	3
α-helix	595-600	6
α-helix	609-622	14
α-helix	625-638	14
α-helix	639-641	3
α-helix	648-659	12
α-helix	661-673	13
α-helix	681-694	14
α-helix	698-719	22
α-helix	728-739	12
α-helix	742-747	6
β-strand	751-753	3	7
β-strand	756-761	6	7
β-strand	764	1	8
β-strand	770-771	2	8
β-strand	779-784	6	8
α-helix	790-792	3
β-strand	796-803	8	8
α-helix	808-827	20
β-strand	838-842	5	8
β-strand	845-849	5	8
α-helix	850-851	2
β-strand	854-856	3	9
α-helix	857-861	5
α-helix	876-884	9
α-helix	887-889	3
α-helix	890-911	22
α-helix	913-916	4
β-strand	921-924	4	9
β-strand	929-931	3	9
α-helix	958-964	7
α-helix	975-993	19
α-helix	995-1003	9
α-helix	1016-1025	10
α-helix	1032-1047	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	A	protein	962	Homo sapiens	P42336 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5DXT_1 Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (chains A)
NREEKILNREIGFAIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYV
YPPNVESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIR
KKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLM
LMAKESLYSQLPMDCFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNV
NIRDIDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSI
CSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNP
NKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELREN
DKEQLKAISTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCL
VKDWPPIKPEQAMELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLD
NLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQV
EAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRL
EECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQN
QGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNK
GEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFG
YKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMML
GSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHA
LN

Ligands and cofactors

ID	Name	Formula	Copies
5H5	(2S)-2-({2-[1-(propan-2-yl)-1H-1,2,4-triazol-5-yl]-5,6-dihydroimidazo[1,2-d][1,…	C19 H22 N6 O3	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326). Heffron, T.P., Heald, R.A., Ndubaku, C. et al. J Med Chem (2016) 59:985-1002. DOI 10.1021/acs.jmedchem.5b01483 · PubMed

Other PDB entries of the same protein (UniProt P42336 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CMK 1.75 Å, Crystal structure of p110alpha-RAS binding domain (RBD) in complex with molecular glue…
9ASF 1.77 Å, Crystal structure of HLA-A*03:01 in complex with a wild-type PIK3CA peptide analogue…
9CX0 1.92 Å, Crystal structure of HLA-A*03:01 E152V mutant in complex with a mutant PIK3CA peptide
7L1C 1.96 Å, Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide
9CWY 1.98 Å, Crystal structure of HLA-A*03:02 in complex with a wild-type PIK3CA peptide
8EXL 1.99 Å, Crystal structure of PI3K-alpha in complex with taselisib
9CX1 2.0 Å, Crystal structure of HLA-A*03:01 L156Q mutant in complex with a mutant PIK3CA peptide
9CML 2.01 Å, Crystal structure of p110alpha-RAS binding domain (RBD) in complex with molecular glue…
9ASG 2.03 Å, Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide analogue (Trp-6…
7L1B 2.04 Å, Crystal structure of HLA-A*03:01 in complex with a wild-type PIK3CA peptide
9CWZ 2.05 Å, Crystal structure of HLA-A*03:02 in complex with a mutant PIK3CA peptide
7JIU 2.12 Å, Human PI3KDELTA in complex with compound 2F

Browse structure collections

About this viewer

MolViewer shows 5DXT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.