Crystal Structure of BAZ2B bromodomain in complex with fragment F39. Determined by X-ray diffraction at 1.65 Å resolution. Released 16 Mar 2016.
Explore 5DYU in 3D Show helices and sheets RCSB PDB PDBe
5DYU contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1860-1862 | 3 | |
| α-helix | 1869-1882 | 14 | |
| α-helix | 1884-1889 | 6 | |
| α-helix | 1901-1904 | 4 | |
| α-helix | 1911-1919 | 9 | |
| α-helix | 1926-1943 | 18 | |
| α-helix | 1949-1969 | 21 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bromodomain adjacent to zinc finger domain protein 2B | A | protein | 116 | Homo sapiens | Q9UIF8 (AlphaFold model) |
>5DYU_1 Bromodomain adjacent to zinc finger domain protein 2B (chains A) SMSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIR EKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFKV
| ID | Name | Formula | Copies |
|---|---|---|---|
| MZ0 | 1H-imidazol-5-ylmethanol | C4 H6 N2 O | 2 |
High-Throughput Fragment Docking into the BAZ2B Bromodomain: Efficient in Silico Screening for X-Ray Crystallography. Lolli, G., Caflisch, A. ACS Chem Biol (2016) 11:800-807. DOI 10.1021/acschembio.5b00914 · PubMed
Other PDB entries of the same protein (UniProt Q9UIF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5DYU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.