5E1T: TRAF1 TRAF domain

Crystal structure of TRAF1 TRAF domain. Determined by X-ray diffraction at 2.8 Å resolution. Released 7 Dec 2016.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,612
Mol. weight: 67.94 kDa
Released: 7 Dec 2016

Explore 5E1T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5E1T contains 24 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	225-262	38
β-strand	268-274	7	1
α-helix	276-283	8
β-strand	290-292	3	2
α-helix	293-295	3
β-strand	296-297	2	2
β-strand	304-310	7	2
α-helix	315-317	3
β-strand	321-329	9	2
α-helix	334-336	3
β-strand	345-350	6	1
α-helix	356-357	2
β-strand	358-362	5	1
α-helix	373-374	2
β-strand	378	1	2
β-strand	382-389	8	2
α-helix	390-392	3
β-strand	402	1	1
β-strand	405-412	8	1

Chain B: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	222-262	41
β-strand	268-274	7	3
α-helix	276-284	9
β-strand	291-292	2	4
α-helix	293-295	3
β-strand	296-297	2	4
β-strand	304-310	7	4
α-helix	315-317	3
β-strand	321-329	9	4
α-helix	330-331	2
α-helix	334-336	3
β-strand	345-349	5	3
α-helix	350-351	2
β-strand	358-362	5	3
β-strand	378	1	4
α-helix	379-381	3
β-strand	382-389	8	4
α-helix	390-394	5
β-strand	402	1	3
β-strand	405-412	8	3

Chain C: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	227-262	36
β-strand	268-274	7	5
α-helix	276-284	9
β-strand	291-292	2	6
α-helix	293-295	3
β-strand	296-297	2	6
β-strand	304-310	7	6
β-strand	321-329	9	6
α-helix	334-336	3
β-strand	345-349	5	5
β-strand	358-362	5	5
α-helix	369-371	3
β-strand	378	1	6
α-helix	379-381	3
β-strand	382-389	8	6
α-helix	390-393	4
β-strand	401-402	2	5
β-strand	405-412	8	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor-associated factor 1	A, B, C	protein	197	Homo sapiens	Q13077 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5E1T_1 TNF receptor-associated factor 1 (chains A, B, C)
HQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRR
CHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPW
PFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHA
YVKDDTMFLKCIVETST

Primary citation

Crystal structure of TRAF1 TRAF domain and its implications in the TRAF1-mediated intracellular signaling pathway. Kim, C.M., Choi, J.Y., Bhat, E.A. et al. Sci Rep (2016) 6:25526-25526. DOI 10.1038/srep25526 · PubMed

Other PDB entries of the same protein (UniProt Q13077 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3M0D 2.8 Å, Crystal structure of the TRAF1:TRAF2:cIAP2 complex
5H10 3.21 Å, TRAF1-TANk complex

Browse structure collections

About this viewer

MolViewer shows 5E1T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.