Crystal structure of TRAF1 TRAF domain. Determined by X-ray diffraction at 2.8 Å resolution. Released 7 Dec 2016.
Explore 5E1T in 3D Show helices and sheets RCSB PDB PDBe
5E1T contains 24 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 225-262 | 38 | |
| β-strand | 268-274 | 7 | 1 |
| α-helix | 276-283 | 8 | |
| β-strand | 290-292 | 3 | 2 |
| α-helix | 293-295 | 3 | |
| β-strand | 296-297 | 2 | 2 |
| β-strand | 304-310 | 7 | 2 |
| α-helix | 315-317 | 3 | |
| β-strand | 321-329 | 9 | 2 |
| α-helix | 334-336 | 3 | |
| β-strand | 345-350 | 6 | 1 |
| α-helix | 356-357 | 2 | |
| β-strand | 358-362 | 5 | 1 |
| α-helix | 373-374 | 2 | |
| β-strand | 378 | 1 | 2 |
| β-strand | 382-389 | 8 | 2 |
| α-helix | 390-392 | 3 | |
| β-strand | 402 | 1 | 1 |
| β-strand | 405-412 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 222-262 | 41 | |
| β-strand | 268-274 | 7 | 3 |
| α-helix | 276-284 | 9 | |
| β-strand | 291-292 | 2 | 4 |
| α-helix | 293-295 | 3 | |
| β-strand | 296-297 | 2 | 4 |
| β-strand | 304-310 | 7 | 4 |
| α-helix | 315-317 | 3 | |
| β-strand | 321-329 | 9 | 4 |
| α-helix | 330-331 | 2 | |
| α-helix | 334-336 | 3 | |
| β-strand | 345-349 | 5 | 3 |
| α-helix | 350-351 | 2 | |
| β-strand | 358-362 | 5 | 3 |
| β-strand | 378 | 1 | 4 |
| α-helix | 379-381 | 3 | |
| β-strand | 382-389 | 8 | 4 |
| α-helix | 390-394 | 5 | |
| β-strand | 402 | 1 | 3 |
| β-strand | 405-412 | 8 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 227-262 | 36 | |
| β-strand | 268-274 | 7 | 5 |
| α-helix | 276-284 | 9 | |
| β-strand | 291-292 | 2 | 6 |
| α-helix | 293-295 | 3 | |
| β-strand | 296-297 | 2 | 6 |
| β-strand | 304-310 | 7 | 6 |
| β-strand | 321-329 | 9 | 6 |
| α-helix | 334-336 | 3 | |
| β-strand | 345-349 | 5 | 5 |
| β-strand | 358-362 | 5 | 5 |
| α-helix | 369-371 | 3 | |
| β-strand | 378 | 1 | 6 |
| α-helix | 379-381 | 3 | |
| β-strand | 382-389 | 8 | 6 |
| α-helix | 390-393 | 4 | |
| β-strand | 401-402 | 2 | 5 |
| β-strand | 405-412 | 8 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TNF receptor-associated factor 1 | A, B, C | protein | 197 | Homo sapiens | Q13077 (AlphaFold model) |
>5E1T_1 TNF receptor-associated factor 1 (chains A, B, C) HQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRR CHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPW PFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHA YVKDDTMFLKCIVETST
Crystal structure of TRAF1 TRAF domain and its implications in the TRAF1-mediated intracellular signaling pathway. Kim, C.M., Choi, J.Y., Bhat, E.A. et al. Sci Rep (2016) 6:25526-25526. DOI 10.1038/srep25526 · PubMed
Other PDB entries of the same protein (UniProt Q13077 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5E1T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.