5E2W: AT8 light chain

Anti-TAU AT8 FAB with triply phosphorylated TAU peptide. Determined by X-ray diffraction at 1.5 Å resolution. Released 24 Feb 2016.

Method: X-ray diffraction
Resolution: 1.5 Å
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 3,580
Mol. weight: 50.17 kDa
Released: 24 Feb 2016

Explore 5E2W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5E2W contains 16 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
β-strand	32	1	9
β-strand	34-40	7	10
β-strand	46-53	8	10
β-strand	58-60	3	10
β-strand	68-73	6	7
α-helix	74-76	3
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-98	7	10
β-strand	102-103	2	10
β-strand	107-109	3	10
β-strand	110-111	2	8
α-helix	115-116	2
β-strand	117	1	11
α-helix	118-119	2
β-strand	120-124	5	12
β-strand	135-145	11	12
β-strand	146	1	11
β-strand	151-154	4	13
α-helix	155-157	3
β-strand	159	1	13
β-strand	163-165	3	12
α-helix	166-168	3
β-strand	169-170	2	12
β-strand	176-185	10	12
α-helix	186-188	3
β-strand	195-200	6	13
α-helix	201-203	3
β-strand	205-210	6	13

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	50-54	5	2
β-strand	58-59	2	2
α-helix	60	1
β-strand	67-72	6	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-111	5	2
β-strand	116	1	4
α-helix	117-118	2
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-130	4
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	150-155	6	6
β-strand	158-159	2	6
β-strand	164-168	5	5
β-strand	178-187	10	5
α-helix	188-192	5
β-strand	196-202	7	6
β-strand	210-215	6	6

Chain P: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	205-206	2
β-strand	208	1	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AT8 light chain	L	protein	219	Mus musculus
AT8 heavy chain	H	protein	222	Mus musculus
Tau-phosphopeptide	P	protein	18	Homo sapiens	P10636 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>5E2W_1 AT8 LIGHT CHAIN (chains L)
DIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIHRMSNLA
SGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCMQHLEYPYTFGGGTRLEVKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (H), FASTA

>5E2W_2 AT8 HEAVY CHAIN (chains H)
DVQLQESGPGLVKPSQSLSLTCSVTDYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNY
NPSLKNRISITRDPSKDQFFLNLNSVTTEDTATYYCTRGSLVWGQGTLVTVSAASTKGPS
VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCHHHHHH

Sequence of entity 3 (P), FASTA

>5E2W_3 TAU-PHOSPHOPEPTIDE (chains P)
RSGYSSPGSPGTPGSRSR

Primary citation

Epitope mapping and structural basis for the recognition of phosphorylated tau by the anti-tau antibody AT8. Malia, T.J., Teplyakov, A., Ernst, R. et al. Proteins (2016) 84:427-434. DOI 10.1002/prot.24988 · PubMed

Other PDB entries of the same protein (UniProt P10636 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ODG 1.0 Å, SVQIVY, Crystal Structure of a tau protein fragment
8KDX 1.01 Å, Tau-S214 Phosphorylation Inhibits Fyn Kinase Interaction and Increases the Decay Time of…
5K7N 1.1 Å, MicroED structure of tau VQIVYK peptide at 1.1 A resolution
9GG8 1.1 Å, Crystal structure of 14-3-3 sigma dC - C38N in complex with Tau pS214 peptide and…
9GG7 1.24 Å, Crystal structure of 14-3-3 sigma dC - C38N in complex with Tau pS324 peptide and…
5V5C 1.25 Å, VQIINK, Structure of the amyloid-spine from microtubule associated protein tau Repeat 2
6FAU 1.25 Å, Crystal structure of C-terminal modified Tau peptide-hybrid 4.2e-I with 14-3-3sigma
8GCK 1.37 Å, Crystal structure of the human CHIP-TPR domain in complex with a 6mer acetylated tau…
4Y5I 1.4 Å, Crystal structure of C-terminal modified Tau peptide-hybrid 126B with 14-3-3sigma
6FAV 1.4 Å, Crystal structure of C-terminal modified Tau peptide-hybrid 4.2f-I with 14-3-3sigma
6FAW 1.4 Å, Crystal structure of C-terminal modified Tau peptide-hybrid 4.2c-I with 14-3-3sigma
9GHK 1.42 Å, Crystal structure of Fyn SH3 domain/tau 214-220 peptide complex

Browse structure collections

About this viewer

MolViewer shows 5E2W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.