Crystal structure of mouse CNTN5 Ig1-Ig4 domains. Determined by X-ray diffraction at 2.6 Å resolution. Released 31 Aug 2016.
Explore 5E4I in 3D Show helices and sheets RCSB PDB PDBe
5E4I contains 12 α-helices and 41 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 96-102 | 7 | 1 |
| β-strand | 107-109 | 3 | 2 |
| β-strand | 117-120 | 4 | 3 |
| β-strand | 123-127 | 5 | 1 |
| α-helix | 129-130 | 2 | |
| β-strand | 131-136 | 6 | 2 |
| β-strand | 139-140 | 2 | 2 |
| α-helix | 143-145 | 3 | |
| β-strand | 149-152 | 4 | 3 |
| β-strand | 155-159 | 5 | 3 |
| α-helix | 163-166 | 4 | |
| β-strand | 168-176 | 9 | 2 |
| β-strand | 179-182 | 4 | 2 |
| β-strand | 186-190 | 5 | 2 |
| β-strand | 193 | 1 | 4 |
| α-helix | 195-197 | 3 | |
| β-strand | 204-206 | 3 | 5 |
| β-strand | 212-214 | 3 | 6 |
| α-helix | 218-219 | 2 | |
| β-strand | 221 | 1 | 4 |
| β-strand | 225-231 | 7 | 5 |
| β-strand | 237 | 1 | 5 |
| α-helix | 238-240 | 3 | |
| β-strand | 244-246 | 3 | 6 |
| β-strand | 253-255 | 3 | 6 |
| α-helix | 260-262 | 3 | |
| β-strand | 264-272 | 9 | 5 |
| β-strand | 278-280 | 3 | 5 |
| α-helix | 281-283 | 3 | |
| β-strand | 284-288 | 5 | 5 |
| β-strand | 297-303 | 7 | 7 |
| β-strand | 308-312 | 5 | 8 |
| β-strand | 317-320 | 4 | 9 |
| β-strand | 322-326 | 5 | 7 |
| α-helix | 328-329 | 2 | |
| β-strand | 330-335 | 6 | 8 |
| β-strand | 345-347 | 3 | 9 |
| β-strand | 352-355 | 4 | 9 |
| α-helix | 360-362 | 3 | |
| β-strand | 364-372 | 9 | 8 |
| β-strand | 375-386 | 12 | 8 |
| β-strand | 387-393 | 7 | 10 |
| β-strand | 398-401 | 4 | 11 |
| β-strand | 406-409 | 4 | 12 |
| β-strand | 411-415 | 5 | 10 |
| α-helix | 417-418 | 2 | |
| β-strand | 419-424 | 6 | 11 |
| β-strand | 427-428 | 2 | 11 |
| β-strand | 436-438 | 3 | 12 |
| β-strand | 441-444 | 4 | 12 |
| α-helix | 449-451 | 3 | |
| β-strand | 453-461 | 9 | 11 |
| β-strand | 464-475 | 12 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Contactin-5 | A | protein | 384 | Mus musculus | P68500 (AlphaFold model) |
>5E4I_1 Contactin-5 (chains A) GSYGPVFVQEPDDVIFPTDSDEKKVALNCEVRGNPSPSYRWLRNGTEIALESDYRYSLID GTFIISNPSELRDSGLYQCLATNSFGSILSREATLQFAYLGNFSGRTRSAVSVREGQGVV LMCSPPPHSPEIIYSWVFNEFPSFVAEDSRRFISQETGNLYISKVQTSDVGSYICLVKNA VTNARVLSPPTPLTLRNDGVMGEYEPKIEVHFPFTVTAAKGTTVKMECFALGNPVPTITW MKVNGYIPSKSRLRKSQAVLEIPNLQLDDAGIYECTAENSRGKNSFRGQLQIFTYPHWVQ KLNDTQLDSGSPLQWECKATGKPRPTYRWLKNGAPLLPQSRVDTVNGILAIQSVNQSDAG MYQCLAENKYGAIYASAELKILAS
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Structural Basis for Interactions Between Contactin Family Members and Protein-tyrosine Phosphatase Receptor Type G in Neural Tissues. Nikolaienko, R.M., Hammel, M., Dubreuil, V. et al. J Biol Chem (2016) 291:21335-21349. DOI 10.1074/jbc.M116.742163 · PubMed
Other PDB entries of the same protein (UniProt P68500 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5E4I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.