Crystal structure of the extracellular part of receptor 2 of human interferon gamma. Determined by X-ray diffraction at 1.8 Å resolution. Released 17 Aug 2016.
Explore 5EH1 in 3D Show helices and sheets RCSB PDB PDBe
5EH1 contains 11 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30 | 1 | 1 |
| α-helix | 31-34 | 4 | |
| β-strand | 37-41 | 5 | 2 |
| β-strand | 44-48 | 5 | 2 |
| α-helix | 59-61 | 3 | |
| β-strand | 62-68 | 7 | 3 |
| β-strand | 75-76 | 2 | 3 |
| α-helix | 79-82 | 4 | |
| β-strand | 87-89 | 3 | 3 |
| β-strand | 93-95 | 3 | 2 |
| β-strand | 110-111 | 2 | 4 |
| β-strand | 112-119 | 8 | 3 |
| β-strand | 122-123 | 2 | 3 |
| β-strand | 124 | 1 | 1 |
| α-helix | 125-126 | 2 | |
| β-strand | 127-128 | 2 | 3 |
| α-helix | 129-131 | 3 | |
| β-strand | 132-133 | 2 | 4 |
| α-helix | 134-137 | 4 | |
| α-helix | 138 | 1 | |
| β-strand | 139 | 1 | 2 |
| α-helix | 140 | 1 | |
| β-strand | 144-151 | 8 | 5 |
| β-strand | 154-160 | 7 | 5 |
| β-strand | 171-181 | 11 | 6 |
| β-strand | 187-192 | 6 | 6 |
| β-strand | 196-199 | 4 | 5 |
| α-helix | 202-203 | 2 | |
| β-strand | 207-218 | 12 | 6 |
| β-strand | 224-226 | 3 | 6 |
| α-helix | 227-232 | 6 | |
| β-strand | 233-236 | 4 | 6 |
| α-helix | 237-238 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interferon gamma receptor 2 | A | protein | 231 | Homo sapiens | P38484 (AlphaFold model) |
>5EH1_1 Interferon gamma receptor 2 (chains A) RSSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYTDSKWFTADIMSIGVN CTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPEN IEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPS RVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQTGHHHHHHE
Water and common crystallization additives (GOL) are not listed.
Crystal structure of human interferon-gamma receptor 2 reveals the structural basis for receptor specificity. Mikulecky, P., Zahradnik, J., Kolenko, P. et al. Acta Crystallogr D Struct Biol (2016) 72:1017-1025. DOI 10.1107/S2059798316012237 · PubMed
Other PDB entries of the same protein (UniProt P38484 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5EH1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.