5EII: Fab Heavy Chain

Structural determination of an protein complex of a Fab with increased solubility. Determined by X-ray diffraction at 2.44 Å resolution. Released 9 Nov 2016.

Method: X-ray diffraction
Resolution: 2.44 Å
Organisms: Homo sapiens, Saccharomyces cerevisiae
Chains: 6
Atoms: 9,056
Mol. weight: 132.26 kDa
Released: 9 Nov 2016

Explore 5EII in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EII contains 45 α-helices and 113 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	32-39	8	2
β-strand	46-52	7	2
β-strand	57-60	4	2
α-helix	62-64	3
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-101	10	2
β-strand	102-103	2	3
β-strand	111-114	4	2
β-strand	118-122	5	2
α-helix	125-127	3
β-strand	128	1	4
α-helix	129-130	2
β-strand	131-135	5	5
α-helix	136-138	3
β-strand	147-156	10	5
β-strand	157	1	4
β-strand	162-165	4	6
α-helix	166-168	3
β-strand	170	1	6
β-strand	174-176	3	5
α-helix	177-179	3
β-strand	180-181	2	5
β-strand	187-195	9	5
α-helix	197-199	3
β-strand	200	1	7
β-strand	203	1	7
β-strand	206-211	6	6
α-helix	212-214	3
β-strand	216-221	6	6

Chain B: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	8
β-strand	10-13	4	9
β-strand	19-25	7	8
β-strand	33-38	6	9
β-strand	45-49	5	9
β-strand	53-54	2	9
α-helix	55	1
β-strand	62-67	6	8
β-strand	70-75	6	8
α-helix	80-82	3
β-strand	85-90	6	9
α-helix	96	1
β-strand	97-98	2	9
β-strand	102-106	5	9
β-strand	111	1	10
α-helix	112-113	2
β-strand	114-118	5	11
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	11
β-strand	140	1	10
β-strand	144-150	7	12
β-strand	153-154	2	12
β-strand	159-163	5	11
α-helix	164-167	4
β-strand	173-182	10	11
α-helix	183-187	5
β-strand	191-198	8	12
β-strand	205-210	6	12

Chain G: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	4-11	8	13
β-strand	16-17	2	14
β-strand	22-30	9	13
β-strand	38-44	7	14
β-strand	55-62	8	14
α-helix	65-66	2
β-strand	68-76	9	13
α-helix	77-80	4
α-helix	81-83	3
β-strand	92-101	10	14
β-strand	104-117	14	14
α-helix	120-124	5
α-helix	132-134	3
β-strand	135-139	5	14
β-strand	145-148	4	14

Chain H: 11 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	15
β-strand	10-12	3	16
β-strand	18-25	8	15
β-strand	32-39	8	16
β-strand	46-52	7	16
α-helix	53-55	3
β-strand	57-60	4	16
α-helix	62-64	3
β-strand	65	1	15
β-strand	68-73	6	15
β-strand	78-83	6	15
α-helix	88-90	3
β-strand	92-101	10	16
β-strand	102-103	2	13
β-strand	111-114	4	16
β-strand	118-122	5	16
α-helix	125-127	3
β-strand	128	1	17
α-helix	129-130	2
β-strand	131-135	5	18
α-helix	136-138	3
α-helix	141-142	2
β-strand	146-156	11	18
β-strand	157	1	17
β-strand	162-165	4	19
α-helix	166-168	3
β-strand	170	1	19
β-strand	174-176	3	18
α-helix	177-179	3
β-strand	180-181	2	18
β-strand	187-196	10	18
α-helix	197-199	3
β-strand	206-211	6	19
α-helix	212-214	3
β-strand	216-221	6	19

Chain I: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-11	8	3
β-strand	16-17	2	20
α-helix	21	1
β-strand	22-30	9	3
β-strand	38-44	7	21
β-strand	55-62	8	21
α-helix	65-66	2
β-strand	68-76	9	3
α-helix	77-80	4
β-strand	98-101	4	21
β-strand	104-110	7	21
β-strand	113	1	22
β-strand	136-137	2	20
β-strand	139	1	22
β-strand	145-148	4	21

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	23
β-strand	10-13	4	24
β-strand	19-25	7	23
β-strand	33-38	6	24
β-strand	45-49	5	24
β-strand	53-54	2	24
α-helix	55	1
β-strand	62-67	6	23
β-strand	70-75	6	23
α-helix	80-82	3
β-strand	85-90	6	24
α-helix	96	1
β-strand	97-98	2	24
β-strand	102-106	5	24
β-strand	111	1	25
α-helix	112-113	2
β-strand	114-118	5	26
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	26
β-strand	140	1	25
β-strand	145-150	6	27
β-strand	153-155	3	27
β-strand	159-163	5	26
α-helix	164-167	4
β-strand	173-182	10	26
α-helix	183-186	4
β-strand	191-197	7	27
β-strand	205-210	6	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab Heavy Chain	A, H	protein	235	Homo sapiens
Fab Light Chain	B, L	protein	215	Homo sapiens
Histone chaperone ASF1	G, I	protein	156	Saccharomyces cerevisiae	P32447 (AlphaFold model)

Sequence of entity 1 (A, H), FASTA

>5EII_1 Fab Heavy Chain (chains A, H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNISYSSIHWVRQAPGKGLEWVASISSYYGS
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRGQASWDYWWAMDYWGQG
TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Sequence of entity 2 (B, L), FASTA

>5EII_2 Fab Light Chain (chains B, L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSDDPITFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (G, I), FASTA

>5EII_3 Histone chaperone ASF1 (chains G, I)
MSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSI
LVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEE
ELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNE

Primary citation

Structural determination of an protein complex of a Fab with increased solubility. Bailey, L.J., Kossiakoff, A.A., Schaefer, Z.P. To be published.

Other PDB entries of the same protein (UniProt P32447 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ROC 1.5 Å, Crystal structure of the histone deposition protein Asf1
5UCB 1.52 Å, Structure of antigen-Fab complex with engineered switch residue region.
2HUE 1.7 Å, Structure of the H3-H4 chaperone Asf1 bound to histones H3 and H4
5UEK 1.7 Å, Structure of antigen-Fab 12E complex with Histone chaperone ASF1
5UEA 1.7 Å, Structure of antigen-Fab complex with Histone chaperone ASF1
6AYZ 2.1 Å, Crystal structure of Asf1-Fab 12E complex
2IDC 2.2 Å, Structure of the Histone H3-Asf1 Chaperone Interaction
4ZBJ 2.25 Å, UBN1 peptide bound to H3.3/H4/Asf1
4EO5 2.35 Å, Yeast Asf1 bound to H3/H4G94P mutant
6AZ2 2.48 Å, Crystal structure of Asf1-Fab 12E complex
4RRP 2.79 Å, Crystal Structure of the Fab complexed with antigen Asf1p, Northeast Structural Genomics…
9AWE 2.8 Å, The crystal structure of an engineered Protein GF with Human Kappa Fab

Browse structure collections

About this viewer

MolViewer shows 5EII directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.