Crystal structure of chromobox homolog 7 (CBX7) chromodomain with MS351. Determined by X-ray diffraction at 2.6 Å resolution. Released 9 Mar 2016.
Explore 5EJW in 3D Show helices and sheets RCSB PDB PDBe
5EJW contains 5 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -10 | 1 | |
| β-strand | -9--8 | 2 | 1 |
| α-helix | -5--4 | 2 | |
| β-strand | 13-22 | 10 | 1 |
| β-strand | 25-32 | 8 | 1 |
| α-helix | 37-39 | 3 | |
| β-strand | 41-44 | 4 | 1 |
| α-helix | 45-47 | 3 | |
| α-helix | 51-67 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chromobox protein homolog 7 | A | protein | 91 | Mus musculus | Q8VDS3 (AlphaFold model) |
>5EJW_1 Chromobox protein homolog 7 (chains A) MGSSHHHHHHSSGLVPRGSHMELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYS TWEPEEHILDPRLVMAYEEKEERDRASGYRK
| ID | Name | Formula | Copies |
|---|---|---|---|
| 5PZ | (1~{R})-2-[2-azanylidene-3-[(2-methylphenyl)methyl]benzimidazol-1-yl]-1-(3,4-di… | C23 H21 Cl2 N3 O | 1 |
Structure-Guided Discovery of Selective Antagonists for the Chromodomain of Polycomb Repressive Protein CBX7. Ren, C., Smith, S.G., Yap, K. et al. ACS Med Chem Lett (2016) 7:601-605. DOI 10.1021/acsmedchemlett.6b00042 · PubMed
Other PDB entries of the same protein (UniProt Q8VDS3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5EJW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.