5EKI: Truncated CCL21

Crystal Structure of Truncated CCL21. Determined by X-ray diffraction at 1.9 Å resolution. Released 5 Oct 2016.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,639
Mol. weight: 53.67 kDa
Released: 5 Oct 2016

Explore 5EKI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EKI contains 17 α-helices and 32 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
α-helix	19-21	3
β-strand	22-28	7	2
β-strand	38-43	6	2
β-strand	51-53	3	2
α-helix	58-67	10
β-strand	74	1	3

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	4
α-helix	19-21	3
β-strand	22-28	7	5
β-strand	31	1	6
β-strand	34	1	6
β-strand	38-43	6	5
β-strand	51-53	3	5
α-helix	58-67	10
β-strand	74	1	7

Chain C: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	7
α-helix	19-21	3
β-strand	22-28	7	8
α-helix	30-32	3
β-strand	38-43	6	8
α-helix	49-50	2
β-strand	51-53	3	8
α-helix	58-67	10
β-strand	74	1	9

Chain D: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	3
α-helix	16-18	3
α-helix	19-21	3
β-strand	22-28	7	10
β-strand	38-43	6	10
β-strand	51-53	3	10
α-helix	58-67	10
β-strand	74	1	11

Chains E and F: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	11
α-helix	19-21	3
β-strand	22-28	7	12
β-strand	38-43	6	12
α-helix	49-50	2
β-strand	51-53	3	12
α-helix	58-67	10
β-strand	74	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 21	A, B, C, D, E, F	protein	79	Homo sapiens	O00585 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>5EKI_1 C-C motif chemokine 21 (chains A, B, C, D, E, F)
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWV
QQLMQHLDKTPSPQKPAQG

Primary citation

Crystallographic Structure of Truncated CCL21 and the Putative Sulfotyrosine-Binding Site. Smith, E.W., Lewandowski, E.M., Moussouras, N.A. et al. Biochemistry (2016) 55:5746-5753. DOI 10.1021/acs.biochem.6b00304 · PubMed

Other PDB entries of the same protein (UniProt O00585 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9XHI 3.2 Å, Structure of the CCL21-CCR7-Gi-scFv16 complex
9KO4 3.3 Å, A Cryo_EM structure of CCR7 complex with CCL21
9L16 3.5 Å, A local Cryo_EM structure of CCR7 complex with CCL21
2L4N Solution Structure of the Chemokine CCL21

Browse structure collections

About this viewer

MolViewer shows 5EKI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.