5ELC: Cholera toxin El Tor B-pentamer
Cholera toxin El Tor B-pentamer in complex with Lewis-y. Determined by X-ray diffraction at 1.5 Å resolution. Released 30 Mar 2016.
- Method
- X-ray diffraction
- Resolution
- 1.5 Å
- Organism
- Vibrio cholerae O1
- Chains
- 10
- Atoms
- 9,536
- Mol. weight
- 124.88 kDa
- Ligands
- CA, BCN, FUC
- Released
- 30 Mar 2016
Explore 5ELC in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5ELC contains 42 α-helices and 60 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| β-strand | 15-23 | 9 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-77 | 19 | |
| α-helix | 80 | 1 | |
| β-strand | 81-88 | 8 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain B: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-77 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain C: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 60-78 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain D: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-23 | 9 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-78 | 20 | |
| α-helix | 80 | 1 | |
| β-strand | 81-88 | 8 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain E: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 61-78 | 18 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain F: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-23 | 9 | 2 |
| β-strand | 26-30 | 5 | 2 |
| β-strand | 37-41 | 5 | 2 |
| β-strand | 47-50 | 4 | 2 |
| α-helix | 51-53 | 3 | |
| α-helix | 61-77 | 17 | |
| α-helix | 80 | 1 | |
| β-strand | 81-88 | 8 | 2 |
| β-strand | 94-102 | 9 | 2 |
Chain G: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-23 | 9 | 2 |
| β-strand | 26-30 | 5 | 2 |
| β-strand | 37-41 | 5 | 2 |
| β-strand | 47-50 | 4 | 2 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-77 | 19 | |
| α-helix | 80 | 1 | |
| β-strand | 81-88 | 8 | 2 |
| β-strand | 94-102 | 9 | 2 |
Chain H: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 2 |
| β-strand | 26-30 | 5 | 2 |
| β-strand | 37-41 | 5 | 2 |
| β-strand | 47-50 | 4 | 2 |
| α-helix | 51-52 | 2 | |
| α-helix | 59-61 | 3 | |
| α-helix | 62-78 | 17 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 2 |
| β-strand | 94-102 | 9 | 2 |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Cholera enterotoxin subunit B | A, B, C, D, E, F, G, H, I, J | protein | 103 | Vibrio cholerae O1 | P01556 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA
>5ELC_1 Cholera enterotoxin subunit B (chains A, B, C, D, E, F, G, H, I, J)
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDS
QKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CA | Calcium ion | Ca | 10 |
| BCN | Bicine | C6 H13 N O4 | 10 |
| FUC | alpha-L-fucopyranose | C6 H12 O5 | 1 |
Primary citation
High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence. Heggelund, J.E., Burschowsky, D., Bjrnestad, V.A. et al. PLoS Pathog (2016) 12:e1005567-e1005567. DOI 10.1371/journal.ppat.1005567 · PubMed
Other PDB entries of the same protein (UniProt P01556 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5LZG 1.13 Å, Cholera toxin El Tor B-pentamer in complex with inhibitor PC262
- 5LZJ 1.2 Å, Cholera toxin El Tor B-pentamer in complex with inhibitor Laura237
- 3CHB 1.25 Å, Cholera toxin B-pentamer complexed with GM1 pentasaccharide
- 1JR0 1.3 Å, Cholera toxin B-pentamer with ligand bmsc-0011
- 1RDP 1.35 Å, Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV3
- 1RF2 1.35 Å, Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV4
- 1RD9 1.44 Å, Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV2
- 1MD2 1.45 Å, Cholera toxin B-pentamer with decavalent ligand bmsc-0013
- 6HJD 1.54 Å, Cholera toxin classical B-pentamer in complex with Lewis-x
- 5ELF 1.55 Å, Cholera toxin El Tor B-pentamer in complex with A-pentasaccharide
- 1RCV 1.6 Å, Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV1
- 5ELE 1.6 Å, Cholera toxin El Tor B-pentamer in complex with A Lewis-y
Browse structure collections
About this viewer
MolViewer shows 5ELC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.