5F0K: VPS35 N terminal region

Structure of VPS35 N terminal region. Determined by X-ray diffraction at 3.07 Å resolution. Released 7 Dec 2016.

Method

X-ray diffraction

Resolution

3.07 Å

Organism

Homo sapiens

Chains

5

Atoms

17,611

Mol. weight

268.62 kDa

Released

7 Dec 2016

Explore 5F0K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5F0K contains 141 α-helices and 0 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 0 β-strands

Molecules and chains

>5F0K_1 Vacuolar protein sorting-associated protein 35 (chains A, B, C, D, E)
GAMGSKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSPKSYYELYM
AISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPRLYLLITVGVVYVKSFPQSRKD
ILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSMDFVLLNFA
EMNKLWVRMQHQGHSRDREKRERERQELRILVGTNLVRLSQLEGVNVERYKQIVLTGILE
QVVNCRDALAQEYLMECIIQVFPDEFHLQTLNPFLRACAELHQNVNVKNIIIALIDRLAL
FAHREDGPGIPADIKLFDIFSQQVATVIQSRQDMPSEDVVSLQVSLINLAMKCYPDRVDY
VDKVLETTVEIFNKLNLEHIATSSAVSKELTRLLKIPVDTYNNILTVLKLKHFHPLFEYF
DYESRKSMSCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQD

Primary citation

Structural Mechanism for Cargo Recognition by the Retromer Complex. Lucas, M., Gershlick, D.C., Vidaurrazaga, A. et al. Cell (2016) 167:1623-1635.e14. DOI 10.1016/j.cell.2016.10.056 · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q96QK1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 8R0J 2.4 Å, Crystal structure of the retromer complex VPS29/VPS35 with the ligand bis-1,3-phenyl…
• 8R02 2.5 Å, Crystal structure of the retromer complex VPS29/VPS35 with the ligand bis-1,3-phenyl…
• 5OSI 2.52 Å, Structure of retromer VPS29-VPS35C subunits complexed with RidL harpin loop (163-176)
• 5F0J 2.7 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3
• 5F0P 2.78 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1(L557M) (SeMet labeled)
• 2R17 2.8 Å, Functional architecture of the retromer cargo-recognition complex
• 5F0M 3.1 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1 (SeMet labeled)
• 8RKS 3.1 Å, Structure of VPS29-VPS35 bound to the LFa motif R21 of Fam21.
• 9Q8M 3.13 Å, VPS35-VPS26-SNX12 Complex
• 5F0L 3.2 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1
• 5OSH 4.3 Å, Structure of retromer VPS29-VPS35C subunits complexed with RidL N-terminal domain (1-236)
• 7BLN 8.9 Å, VPS35/VPS29 arch of metazoan membrane-assembled retromer:SNX3 complex modelled with…

Browse structure collections

About this viewer

MolViewer shows 5F0K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.