5F2U: Fully modified farnesylated INPP5E Peptide

Structure of Fully modified farnesylated INPP5E Peptide in complex with PDE6D. Determined by X-ray diffraction at 1.85 Å resolution. Released 13 Apr 2016.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,615
Mol. weight: 36.08 kDa
Ligands: FAR
Released: 13 Apr 2016

Explore 5F2U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5F2U contains 12 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
β-strand	15-24	10	1
β-strand	30-34	5	1
β-strand	44-49	6	2
α-helix	51-55	5
β-strand	58-67	10	1
β-strand	71-82	12	2
β-strand	85-97	13	2
β-strand	101-110	10	1
β-strand	111	1	3
α-helix	112-113	2
α-helix	114-116	3
α-helix	117-119	3
α-helix	120-123	4
β-strand	127-135	9	2
β-strand	138-149	12	2

Chain B: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	4-14	11
β-strand	15-24	10	4
β-strand	30-34	5	4
β-strand	44-49	6	5
α-helix	51-55	5
β-strand	58-67	10	4
β-strand	71-82	12	5
β-strand	85-97	13	5
β-strand	101-110	10	4
β-strand	111	1	6
α-helix	112-113	2
α-helix	114-116	3
α-helix	117-119	3
α-helix	120-123	4
β-strand	127-135	9	5
β-strand	138-149	12	5

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	641	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta	A, B	protein	149	Homo sapiens	O43924 (AlphaFold model)
Phosphatidylinositol 4,5-bisphosphate 5-phosphatase, s-farnesyl-l-cysteine methyl ester	C, D	protein	5	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>5F2U_1 Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (chains A, B)
SAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSR
ELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPAS
VLTGNVIIETKFFDDDLLVSTSRVRLFYV

Sequence of entity 2 (C, D), FASTA

>5F2U_2 Phosphatidylinositol 4,5-bisphosphate 5-phosphatase, s-farnesyl-l-cysteine methyl ester (chains C, D)
SSTIC

Ligands and cofactors

ID	Name	Formula	Copies
FAR	Farnesyl	C15 H26	2

Primary citation

PDE6delta-mediated sorting of INPP5E into the cilium is determined by cargo-carrier affinity. Fansa, E.K., Koesling, S.K., Zent, E. et al. Nat Commun (2016) 7:11366. DOI 10.1038/NCOMMS11366 · PubMed

Other PDB entries of the same protein (UniProt O43924 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ML3 1.4 Å, The crystal structure of PDE6D in complex to Deltasonamide1
4JV8 1.45 Å, The crystal structure of PDE6D in complex with rac-S1
7Q9Q 1.45 Å, Crystal structure of PDE6D Geranylgeranylated cystein complex
7PAD 1.49 Å, The crystal structure of DW-0254 in complex with PDE6D
5ML2 1.6 Å, The crystal structure of PDE6D in complex with inhibitor-3
9HMC 1.65 Å, Crystal structure of PDE6D in complex with compound 5e
3T5G 1.7 Å, Structure of fully modified farnesylated Rheb in complex with PDE6D
4JVB 1.75 Å, Crystal structure of PDE6D in complex with the inhibitor rac-2
1KSH 1.8 Å, Complex of Arl2 and PDE delta, Crystal Form 2 (native)
9RP6 1.8 Å, Crystal structure of covalent PDE6delta adduct modified by compound 13b
7PAE 1.85 Å, The crystal structure of Deltarasin in complex with PDE6D
7Q9S 1.85 Å, Crystal structure of PDE6D KRas peptide complex with Compound-1

Browse structure collections

About this viewer

MolViewer shows 5F2U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.