5FBZ: Enzyme subtilase SubHal from Bacillus halmapalus

Structure of subtilase SubHal from Bacillus halmapalus - complex with chymotrypsin inhibitor CI2A. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 May 2016.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Bacillus halmapalus, Hordeum vulgare
Chains: 5
Atoms: 8,682
Mol. weight: 107.73 kDa
Ligands: CA
Released: 18 May 2016

Explore 5FBZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FBZ contains 40 α-helices and 74 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	2-7	6
α-helix	10-17	8
β-strand	25-30	6	1
β-strand	50-55	6	1
α-helix	68-77	10
β-strand	90-95	6	1
α-helix	110-119	10
β-strand	124-127	4	1
β-strand	129-130	2	2
β-strand	131	1	3
α-helix	139-150	12
β-strand	154-158	5	1
α-helix	169-170	2
β-strand	171	1	3
β-strand	179-184	6	1
α-helix	189-191	3
α-helix	193-195	3
β-strand	201	1	1
α-helix	202	1
β-strand	219-222	4	1
β-strand	226-229	4	4
α-helix	230-231	2
α-helix	236-238	3
β-strand	241-244	4	4
β-strand	247-250	4	4
β-strand	252	1	5
α-helix	253-274	22
α-helix	281-291	11
α-helix	292	1
β-strand	293	1	1
α-helix	294	1
β-strand	308	1	1
α-helix	311-315	5
β-strand	318-321	4	6
β-strand	326	1	7
β-strand	331-338	8	8
β-strand	344-349	6	6
α-helix	352-356	5
β-strand	366-372	7	8
β-strand	378-380	3	8
β-strand	385	1	9
β-strand	398-403	6	6
α-helix	406-407	2
β-strand	409-419	11	8
β-strand	425	1	7
β-strand	428-432	5	6

Chain B: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	23	1	10
α-helix	25-27	3
β-strand	31	1	11
α-helix	32-42	11
β-strand	47-52	6	10
β-strand	57-58	2	2
β-strand	60	1	5
β-strand	65-70	6	10
β-strand	75	1	11
β-strand	76	1	10
β-strand	81-82	2	10

Chain C: 16 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	2-7	6
α-helix	10-17	8
β-strand	25-30	6	12
β-strand	50-55	6	12
α-helix	68-77	10
β-strand	90-95	6	12
α-helix	110-119	10
β-strand	124-127	4	12
β-strand	129-130	2	13
β-strand	131	1	14
α-helix	139-150	12
β-strand	154-158	5	12
α-helix	169-170	2
β-strand	171	1	14
β-strand	179-184	6	12
α-helix	189-191	3
β-strand	192	1	9
α-helix	193-195	3
α-helix	200	1
β-strand	201	1	12
α-helix	202	1
β-strand	219-222	4	12
β-strand	226-229	4	15
α-helix	236-238	3
β-strand	241-242	2	15
β-strand	247-250	4	15
α-helix	253-274	22
α-helix	281-291	11
β-strand	293	1	12
β-strand	308	1	12
α-helix	311-315	5
β-strand	318-321	4	16
β-strand	326	1	17
β-strand	331-338	8	18
β-strand	344-349	6	16
α-helix	352-354	3
β-strand	366-372	7	18
β-strand	378-380	3	18
β-strand	398-403	6	16
α-helix	406-407	2
β-strand	409-419	11	18
β-strand	425	1	17
β-strand	428-432	5	16

Chain D: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	23	1	19
α-helix	25-27	3
β-strand	31	1	20
α-helix	32-42	11
β-strand	47-52	6	21
β-strand	57-58	2	13
β-strand	65-70	6	21
β-strand	75	1	20
β-strand	76	1	21
β-strand	81	1	19
β-strand	82	1	21

Chain E: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	281	1
β-strand	282	1	8
α-helix	283	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Enzyme subtilase SubHal from Bacillus halmapalus	A, C	protein	433	Bacillus halmapalus	A0A182DWC7 (AlphaFold model)
Subtilisin-chymotrypsin inhibitor-2A	B, D	protein	72	Hordeum vulgare	P01053 (AlphaFold model)
Autoproteolytic fragment of enzyme subtilase SubHal	E	protein	5	Bacillus halmapalus

Sequence of entity 1 (A, C), FASTA

>5FBZ_1 Enzyme subtilase SubHal from Bacillus halmapalus (chains A, C)
NDVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTN
NANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSA
GARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAIT
VGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFW
ANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFP
NGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTAS
LTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNV
PVGPQTFSLAIVH

Sequence of entity 2 (B, D), FASTA

>5FBZ_2 Subtilisin-chymotrypsin inhibitor-2A (chains B, D)
TGAGDRHNLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVD
KLDNIAEVPRVG

Sequence of entity 3 (E), FASTA

>5FBZ_3 Autoproteolytic fragment of enzyme subtilase SubHal (chains E)
KPSLL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	6

Primary citation

Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family. Dohnalek, J., McAuley, K.E., Brzozowski, A.M. et al. Book (2016):203-266. DOI 10.4032/9789814669337

Other PDB entries of the same protein (UniProt A0A182DWC7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FAX 2.0 Å, Structure of subtilase SubHal from Bacillus halmapalus

Browse structure collections

About this viewer

MolViewer shows 5FBZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.