5FR6: Polycomb ULD complex

The structure of polycomb ULD complex. Determined by X-ray diffraction at 2.51 Å resolution. Released 16 Nov 2016.

Method: X-ray diffraction
Resolution: 2.51 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 724
Mol. weight: 14.1 kDa
Released: 16 Nov 2016

Explore 5FR6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FR6 contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	130-137	8	1
β-strand	162-167	6	1
β-strand	171	1	2
α-helix	172-182	11
β-strand	189-194	6	1
β-strand	199	1	1
β-strand	205	1	2
α-helix	206-213	8
β-strand	221-229	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polycomb complex protein bmi-1	A	protein	115	HOMO SAPIENS	P35226 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5FR6_1 POLYCOMB COMPLEX PROTEIN BMI-1 (chains A)
DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMK

Primary citation

Bmi1 Regulates Prc1 Architecture and Activity Through Homo-and Hetero-Oligomerization. Gray, F., Cho, H.J., Shihan, S. et al. Nat Commun (2016) 7:13343. DOI 10.1038/NCOMMS13343 · PubMed

Other PDB entries of the same protein (UniProt P35226 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WI7 1.7 Å, RING1B-BMI1 fusion in closed conformation
2H0D 2.5 Å, Structure of a Bmi-1-Ring1B Polycomb group ubiquitin ligase complex
3RPG 2.65 Å, Bmi1/Ring1b-UbcH5c complex structure
28OE 2.74 Å, Human PRC1.4 in complex with native UBCH5C bound to a H3Kc27me3 mononucleosome
9DBY 2.8 Å, ncPRC1RYBP bound to singly modified H2AK119Ub nucleosome
9V9Q 2.8 Å, Cryo-EM structure of the cPRC1-UbcH5c E3-E2 complex bound to the H2BK120ub-modified…
8PP7 2.91 Å, human RYBP-PRC1 bound to mononucleosome
9DGG 2.98 Å, ncPRC1RYBP bound to unmodified nucleosome
9V6S 3.0 Å, Cryo-EM structure of a single cPRC1 complex engaged on one face of an endogenous 147-bp…
8GRM 3.05 Å, Cryo-EM structure of PRC1 bound to H2AK119-UbcH5b-Ub nucleosome
6WI8 3.09 Å, Inhibitor compound-induced confrontational change in Ring1b-Bmi1 domain structure
9DDE 3.2 Å, ncPRC1RYBP bound to H2AK119Ub/H1.4 chromatosome

Browse structure collections

About this viewer

MolViewer shows 5FR6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.