5FZP: Dispase autolysis-inducing protein

Structure of the dispase autolysis inducing protein from Streptomyces mobaraensis. Determined by X-ray diffraction at 1.7 Å resolution. Released 10 Aug 2016.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: STREPTOMYCES MOBARAENSIS
Chains: 2
Atoms: 6,026
Mol. weight: 73.18 kDa
Ligands: CA
Released: 10 Aug 2016

Explore 5FZP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FZP contains 3 α-helices and 74 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
β-strand	16	1	2
β-strand	21-24	4	3
β-strand	34	1	1
β-strand	42	1	4
β-strand	46-49	4	5
β-strand	56-60	5	5
β-strand	63-67	5	5
β-strand	73	1	2
β-strand	75-79	5	5
β-strand	86-89	4	6
β-strand	94-98	5	6
β-strand	100	1	7
β-strand	105-109	5	6
β-strand	112-115	4	6
β-strand	123-128	6	7
β-strand	136-140	5	7
β-strand	145-148	4	7
β-strand	156-158	3	7
β-strand	169-175	7	8
β-strand	178-186	9	8
β-strand	189	1	9
β-strand	191-194	4	8
β-strand	202-203	2	8
α-helix	204	1
β-strand	205	1	10
β-strand	215-222	8	9
β-strand	230-236	7	9
β-strand	249-254	6	9
β-strand	260	1	10
β-strand	262-266	5	9
β-strand	279-281	3	11
β-strand	288-295	8	11
α-helix	297-299	3
β-strand	301-308	8	11
β-strand	313-319	7	11
β-strand	323-329	7	3
β-strand	337-342	6	3
β-strand	343	1	4

Chain B: 1 helix, 37 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	12
β-strand	16	1	13
β-strand	21-24	4	14
β-strand	34	1	12
β-strand	42	1	15
β-strand	46-49	4	16
β-strand	56-60	5	16
β-strand	63-67	5	16
β-strand	73	1	13
β-strand	75-79	5	16
β-strand	86-90	5	17
β-strand	94-98	5	17
β-strand	100	1	18
β-strand	105-109	5	17
β-strand	112-115	4	17
β-strand	123-128	6	18
β-strand	136-140	5	18
β-strand	145-148	4	18
β-strand	156-158	3	18
β-strand	169-175	7	19
β-strand	178-186	9	19
β-strand	189	1	20
β-strand	190-194	5	19
β-strand	202-203	2	19
β-strand	205	1	21
β-strand	215-222	8	20
β-strand	230-236	7	20
β-strand	249-254	6	20
β-strand	260	1	21
β-strand	262-266	5	20
β-strand	279-281	3	22
β-strand	288-295	8	22
α-helix	297-299	3
β-strand	301-308	8	22
β-strand	313-319	7	22
β-strand	323-329	7	14
β-strand	337-342	6	14
β-strand	343	1	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dispase autolysis-inducing protein	A, B	protein	348	STREPTOMYCES MOBARAENSIS	P84908 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5FZP_1 DISPASE AUTOLYSIS-INDUCING PROTEIN (chains A, B)
ADSTSGWRAPSCTKVTGDGAVTFTTDDGATLAPTTGTLQSVSYTHGLVALDTPNTLLATH
NDELQRSTDAGCTWTKVATLGSGSTWLTAATGGRAFAWEKNGGYLARVDGRTVTKLSSPS
ADIVGVGTDKARRDHVRLAGSDGQLYDSTDAGATWKPLGKLAFGPGASVYTVSFDPADLD
HAVAGGMTTGGAVTTDGGATWTAATGLSATAGGKSNLFAASVSPADRNVVYALGIDLVEA
APNSGAEGRHLYRSTDGGRTYTRIVDDTPDTELTNSTLLAPSPVDPNVLYFEYGTYFQAY
GTDLYRYDARTGKVGKTHNAHDGISAIAFNPARPSVMYLGLEEVQIHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structure of the Dispase Autolysis Inducing Protein from Streptomyces Mobaraensis and Glutamine Cross-Linking Sites for Transglutaminase. Fiebig, D., Schmelz, S., Zindel, S. et al. J Biol Chem (2016) 291:20417. DOI 10.1074/JBC.M116.731109 · PubMed

Other PDB entries of the same protein (UniProt P84908 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FHP 1.7 Å, DAIP in complex with a C-terminal fragment of thermolysin

Browse structure collections

About this viewer

MolViewer shows 5FZP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.