BACE-1 in complex with (7aR)-7a-(5-cyanothiophen-2-yl)-6-(5-fluoro-4-methyl-6-(methylthio)pyrimidin-2-yl)-3-methyl-4-oxooctahydro-2H-pyrrolo[3,4-d]pyrimidin-2-iminium. Determined by X-ray diffraction at 1.49 Å resolution. Released 16 Mar 2016.
Explore 5HDZ in 3D Show helices and sheets RCSB PDB PDBe
5HDZ contains 27 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 67-70 | 4 | 1 |
| β-strand | 74-81 | 8 | 1 |
| β-strand | 86-93 | 8 | 1 |
| β-strand | 99-102 | 4 | 1 |
| α-helix | 115-117 | 3 | |
| β-strand | 122-131 | 10 | 1 |
| β-strand | 136-147 | 12 | 1 |
| β-strand | 155-167 | 13 | 1 |
| α-helix | 171 | 1 | |
| β-strand | 178-181 | 4 | 1 |
| α-helix | 185-187 | 3 | |
| α-helix | 197-204 | 8 | |
| β-strand | 211-215 | 5 | 1 |
| α-helix | 224-229 | 6 | |
| β-strand | 233-237 | 5 | 1 |
| α-helix | 242-244 | 3 | |
| β-strand | 245-253 | 9 | 1 |
| β-strand | 257 | 1 | 2 |
| β-strand | 260 | 1 | 2 |
| β-strand | 261 | 1 | 3 |
| β-strand | 264-269 | 6 | 4 |
| β-strand | 272-273 | 2 | 4 |
| α-helix | 278-282 | 5 | |
| β-strand | 286-288 | 3 | 3 |
| β-strand | 295-298 | 4 | 3 |
| α-helix | 299-312 | 14 | |
| α-helix | 320-323 | 4 | |
| β-strand | 329-331 | 3 | 5 |
| α-helix | 338-340 | 3 | |
| α-helix | 342-343 | 2 | |
| β-strand | 344-349 | 6 | 4 |
| β-strand | 355-361 | 7 | 4 |
| α-helix | 363-366 | 4 | |
| β-strand | 367-370 | 4 | 5 |
| β-strand | 379-383 | 5 | 5 |
| β-strand | 385-388 | 4 | 3 |
| β-strand | 392-394 | 3 | 3 |
| α-helix | 396-399 | 4 | |
| β-strand | 402-407 | 6 | 1 |
| β-strand | 412-418 | 7 | 1 |
| β-strand | 430-436 | 7 | 4 |
| α-helix | 440-443 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 67-70 | 4 | 6 |
| β-strand | 74-81 | 8 | 6 |
| β-strand | 86-93 | 8 | 6 |
| β-strand | 99-102 | 4 | 6 |
| α-helix | 115-117 | 3 | |
| β-strand | 122-132 | 11 | 6 |
| β-strand | 135-147 | 13 | 6 |
| β-strand | 155-167 | 13 | 6 |
| β-strand | 178-181 | 4 | 6 |
| α-helix | 185-187 | 3 | |
| α-helix | 197-204 | 8 | |
| β-strand | 211-215 | 5 | 6 |
| α-helix | 224-229 | 6 | |
| β-strand | 233-237 | 5 | 6 |
| α-helix | 242-244 | 3 | |
| β-strand | 245-253 | 9 | 6 |
| β-strand | 257 | 1 | 7 |
| β-strand | 260 | 1 | 7 |
| β-strand | 261 | 1 | 8 |
| β-strand | 264-269 | 6 | 9 |
| β-strand | 272-273 | 2 | 9 |
| α-helix | 278-282 | 5 | |
| β-strand | 286-288 | 3 | 8 |
| β-strand | 295-298 | 4 | 8 |
| α-helix | 299-312 | 14 | |
| α-helix | 320-323 | 4 | |
| β-strand | 329-331 | 3 | 10 |
| α-helix | 338-340 | 3 | |
| α-helix | 342-343 | 2 | |
| β-strand | 344-349 | 6 | 9 |
| β-strand | 355-361 | 7 | 9 |
| α-helix | 363-366 | 4 | |
| β-strand | 367-370 | 4 | 10 |
| β-strand | 379-383 | 5 | 10 |
| β-strand | 385-388 | 4 | 8 |
| β-strand | 392-394 | 3 | 8 |
| α-helix | 396-399 | 4 | |
| β-strand | 402-407 | 6 | 6 |
| β-strand | 412-418 | 7 | 6 |
| β-strand | 430-436 | 7 | 9 |
| α-helix | 440-443 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-secretase 1 | A, B | protein | 414 | Homo sapiens | P56817 (AlphaFold model) |
>5HDZ_1 Beta-secretase 1 (chains A, B) LRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFA VGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANI AAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGF PLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKE YNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNI FPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIME GFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDEST
| ID | Name | Formula | Copies |
|---|---|---|---|
| 954 | 5-{(2E,4aR,7aR)-6-[5-fluoro-4-methyl-6-(methylsulfanyl)pyrimidin-2-yl]-2-imino-… | C18 H18 F N7 O S2 | 2 |
Structure-Based Design of an Iminoheterocyclic beta-Site Amyloid Precursor Protein Cleaving Enzyme (BACE) Inhibitor that Lowers Central A beta in Nonhuman Primates. Mandal, M., Wu, Y., Misiaszek, J. et al. J Med Chem (2016) 59:3231-3248. DOI 10.1021/acs.jmedchem.5b01995 · PubMed
Other PDB entries of the same protein (UniProt P56817 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5HDZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.