Phosphatase domain of PP5 bound to a phosphomimetic Cdc37 substrate peptide. Determined by X-ray diffraction at 2.27 Å resolution. Released 27 Jul 2016.
Explore 5HPE in 3D Show helices and sheets RCSB PDB PDBe
5HPE contains 13 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 182 | 1 | 1 |
| β-strand | 185 | 1 | 1 |
| α-helix | 188-199 | 12 | |
| α-helix | 206-220 | 15 | |
| β-strand | 226-229 | 4 | 2 |
| β-strand | 236-240 | 5 | 3 |
| α-helix | 247-257 | 11 | |
| β-strand | 261 | 1 | 4 |
| β-strand | 264 | 1 | 4 |
| β-strand | 266-269 | 4 | 3 |
| α-helix | 279-292 | 14 | |
| β-strand | 297-300 | 4 | 3 |
| α-helix | 307-313 | 7 | |
| α-helix | 315-322 | 8 | |
| α-helix | 325-335 | 11 | |
| β-strand | 341-344 | 4 | 2 |
| β-strand | 348-351 | 4 | 2 |
| α-helix | 363-368 | 6 | |
| α-helix | 374-376 | 3 | |
| α-helix | 380-386 | 7 | |
| β-strand | 388-389 | 2 | 5 |
| β-strand | 395-397 | 3 | 5 |
| β-strand | 404-406 | 3 | 5 |
| α-helix | 408-417 | 10 | |
| β-strand | 422-425 | 4 | 2 |
| β-strand | 434-437 | 4 | 2 |
| α-helix | 438-440 | 3 | |
| β-strand | 442-445 | 4 | 2 |
| α-helix | 451-453 | 3 | |
| β-strand | 459-465 | 7 | 3 |
| β-strand | 468-476 | 9 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein phosphatase 5,Hsp90 co-chaperone Cdc37 | A | protein | 350 | Homo sapiens | P53041 (AlphaFold model), Q16543 (AlphaFold model) |
>5HPE_1 Serine/threonine-protein phosphatase 5,Hsp90 co-chaperone Cdc37 (chains A) EYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKET EKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYP DHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGG LFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAF LEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFH QFTAVPHPNVKPMAYANTLLQLGMMGSGSGSASRSVWDHIEVEDDEDETH
Structural and functional basis of protein phosphatase 5 substrate specificity. Oberoi, J., Dunn, D.M., Woodford, M.R. et al. Proc Natl Acad Sci U S A (2016) 113:9009-9014. DOI 10.1073/pnas.1603059113 · PubMed
Other PDB entries of the same protein (UniProt P53041 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5HPE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.