Monomeric IgG4 Fc. Determined by X-ray diffraction at 1.95 Å resolution. Released 17 Aug 2016.
Explore 5HVW in 3D Show helices and sheets RCSB PDB PDBe
5HVW contains 9 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 239-243 | 5 | 1 |
| α-helix | 244-246 | 3 | |
| α-helix | 247-251 | 5 | |
| β-strand | 258-266 | 9 | 1 |
| β-strand | 273-279 | 7 | 2 |
| β-strand | 282-284 | 3 | 2 |
| β-strand | 288-289 | 2 | 1 |
| α-helix | 290-292 | 3 | |
| β-strand | 293-294 | 2 | 1 |
| β-strand | 300-307 | 8 | 1 |
| α-helix | 310-314 | 5 | |
| β-strand | 319-325 | 7 | 2 |
| β-strand | 328-336 | 9 | 2 |
| α-helix | 338-340 | 3 | |
| β-strand | 344 | 1 | 3 |
| β-strand | 347-351 | 5 | 4 |
| α-helix | 352-354 | 3 | |
| α-helix | 357-359 | 3 | |
| β-strand | 362-372 | 11 | 4 |
| β-strand | 373 | 1 | 3 |
| β-strand | 378-383 | 6 | 5 |
| β-strand | 386-388 | 3 | 5 |
| β-strand | 391-393 | 3 | 4 |
| α-helix | 394-396 | 3 | |
| β-strand | 397-398 | 2 | 4 |
| β-strand | 404-413 | 10 | 4 |
| α-helix | 414-418 | 5 | |
| β-strand | 424-428 | 5 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ig gamma-4 chain C region | A | protein | 210 | Homo sapiens | P01861 (AlphaFold model) |
>5HVW_1 Ig gamma-4 chain C region (chains A) LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREE QFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTFPPS QEEMTKNQVSLRCLVKGFYPSDIAVEWESNGQPENNYKTTKPVLDSDGSFRLESRLTVDK SRWQEGNVFSCSVMHEALHNHYTQKSLSLS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (GOL) are not listed.
Generation and Characterization of an IgG4 Monomeric Fc Platform. Shan, L., Colazet, M., Rosenthal, K.L. et al. PLoS One (2016) 11:e0160345-e0160345. DOI 10.1371/journal.pone.0160345 · PubMed
Other PDB entries of the same protein (UniProt P01861 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5HVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.