5I4H: Cathepsin L1

Caught in the Act: The Crystal Structure of cleaved Cathepsin L bound to the active site of Cathepsin L. Determined by X-ray diffraction at 1.42 Å resolution. Released 13 Apr 2016.

Method: X-ray diffraction
Resolution: 1.42 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,030
Mol. weight: 24.58 kDa
Released: 13 Apr 2016

Explore 5I4H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5I4H contains 9 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	1
α-helix	7-10	4
α-helix	14-16	3
β-strand	18	1	2
β-strand	23	1	3
α-helix	25-42	18
β-strand	48	1	4
α-helix	50-56	7
β-strand	66	1	3
α-helix	70-80	11
β-strand	85	1	4

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	112-114	3	1
α-helix	115-116	2
α-helix	119-129	11
β-strand	132-136	5	1
α-helix	141-144	4
β-strand	150-151	2	1
β-strand	163-172	10	1
β-strand	181-186	6	1
β-strand	189	1	2
β-strand	195	1	1
β-strand	198-202	5	1
α-helix	208-210	3
β-strand	216-218	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cathepsin L1	A	protein	106	Homo sapiens	P07711 (AlphaFold model)
Cathepsin L1	B	protein	112	Homo sapiens	P07711 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5I4H_1 Cathepsin L1 (chains A)
EAPRSVDWREKGYVTPVKNQGQCGSSWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGP
QGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYS

Sequence of entity 2 (B), FASTA

>5I4H_2 Cathepsin L1 (chains B)
DAGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVV
GYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV

Primary citation

Caught in the act: the crystal structure of cleaved cathepsin L bound to the active site of Cathepsin L. Sosnowski, P., Turk, D. FEBS Lett (2016) 590:1253-1261. DOI 10.1002/1873-3468.12140 · PubMed

Other PDB entries of the same protein (UniProt P07711 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XU3 0.9 Å, Cathepsin L with a nitrile inhibitor
5MAE 1.0 Å, CATHEPSIN L IN COMPLEX WITH (2S,4R)-4-(2-Chloro-4-methoxy-benzenesulfonyl)-1-[3-(5-chloro…
5MAJ 1.0 Å, CATHEPSIN L IN COMPLEX WITH 4-[cyclopentyl(imidazo[1,2-a]pyridin-2-ylmethyl)amino]-6-morp…
2XU4 1.12 Å, Cathepsin L with a nitrile inhibitor
5MQY 1.13 Å, CATHEPSIN L IN COMPLEX WITH 4-[1,3-benzodioxol-5-ylmethyl(2-phenoxyethyl)amino]-5-fluorop…
2YJC 1.14 Å, Cathepsin L with a nitrile inhibitor
2YJ2 1.15 Å, Cathepsin L with a nitrile inhibitor
3HHA 1.27 Å, Crystal structure of cathepsin L in complex with AZ12878478
2YJ8 1.3 Å, Cathepsin L with a nitrile inhibitor
2YJ9 1.35 Å, Cathepsin L with a nitrile inhibitor
7Z58 1.35 Å, Crystal structure of human Cathepsin L in complex with covalently bound Calpeptin
6EZP 1.37 Å, CATHEPSIN L IN COMPLEX WITH (3S,14E)-19-chloro-N-(1-cyanocyclopropyl)-5-oxo-12,17-dioxa-4…

Browse structure collections

About this viewer

MolViewer shows 5I4H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.