5IH4: Human Casein Kinase 1 isoform delta apo

Human Casein Kinase 1 isoform delta apo (kinase domain). Determined by X-ray diffraction at 1.9 Å resolution. Released 13 Apr 2016.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,643
Mol. weight: 34.61 kDa
Ligands: SRT, ZN
Released: 13 Apr 2016

Explore 5IH4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IH4 contains 19 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	9-17	9	1
β-strand	22-28	7	1
β-strand	33-41	9	1
α-helix	49-58	10
α-helix	66-67	2
β-strand	68-74	7	1
β-strand	77-82	6	1
β-strand	88	1	2
α-helix	89-95	7
α-helix	102-121	20
β-strand	124-125	2	3
α-helix	131-133	3
β-strand	134-136	3	2
α-helix	139-141	3
α-helix	144	1
β-strand	145-147	3	2
β-strand	154-155	2	3
β-strand	157	1	4
α-helix	163	1
β-strand	164	1	4
α-helix	165-167	3
α-helix	171-173	3
α-helix	177-179	3
α-helix	182-185	4
α-helix	188-190	3
α-helix	192-208	17
α-helix	224-234	11
α-helix	237-241	5
α-helix	247-257	11
α-helix	262-264	3
α-helix	266-280	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Casein kinase I isoform delta	A	protein	294	Homo sapiens	P48730 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5IH4_1 Casein kinase I isoform delta (chains A)
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK

Ligands and cofactors

ID	Name	Formula	Copies
SRT	S,r meso-tartaric acid	C4 H6 O6	1
ZN	Zinc ion	Zn	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Epiblastin A Induces Reprogramming of Epiblast Stem Cells Into Embryonic Stem Cells by Inhibition of Casein Kinase 1. Ursu, A., Illich, D.J., Takemoto, Y. et al. Cell Chem Biol (2016) 23:494-507. DOI 10.1016/j.chembiol.2016.02.015 · PubMed

Other PDB entries of the same protein (UniProt P48730 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SIX 1.23 Å, CK1d in complex with IG130
6RCG 1.4 Å, Crystal structure of Casein kinase 1 delta (CK1 delta) complexed with SR3029 inhibitor
6RCH 1.45 Å, Crystal structure of Casein kinase I isoform delta (CK1 delta) complexed with SR4133…
8IZC 1.45 Å, Human CK1 Delta Kinase structure bound to Inhibitor
9SIV 1.5 Å, Phosphorylated CK1d in complex with IG84
9SIZ 1.5 Å, CK1d in complex with IG138
9SIW 1.55 Å, CK1d in complex with IG111
6PXN 1.55 Å, Human Casein Kinase 1 delta Tau mutant (R178C)
6GZM 1.59 Å, Crystal Structure of Human CKIdelta with A86
9SJ1 1.6 Å, CK1d in complex with IG84
8D7O 1.65 Å, Human Casein kinase 1 delta in complex with phosphorylated human PERIOD2 FASP peptide
8D7N 1.66 Å, Human Casein kinase 1 delta in complex with phosphorylated human PERIOD2 FASP peptide

Browse structure collections

About this viewer

MolViewer shows 5IH4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.