X-ray structure of the N-terminal domain of human doublecortin. Determined by X-ray diffraction at 2.48 Å resolution. Released 23 Mar 2016.
Explore 5IN7 in 3D Show helices and sheets RCSB PDB PDBe
5IN7 contains 2 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 134-140 | 7 | 1 |
| β-strand | 149-153 | 5 | 1 |
| α-helix | 161-172 | 12 | |
| β-strand | 184-187 | 4 | 1 |
| β-strand | 193 | 1 | 1 |
| β-strand | 205-209 | 5 | 1 |
| β-strand | 220-222 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 134-140 | 7 | 3 |
| β-strand | 149-153 | 5 | 3 |
| α-helix | 161-172 | 12 | |
| β-strand | 184-187 | 4 | 3 |
| β-strand | 193-194 | 2 | 3 |
| β-strand | 205-209 | 5 | 3 |
| β-strand | 220-222 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neuronal migration protein doublecortin | A, B | protein | 105 | Homo sapiens | O43602 (AlphaFold model) |
>5IN7_1 Neuronal migration protein doublecortin (chains A, B) LSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIY TIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWSVNV
Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies. Burger, D., Stihle, M., Sharma, A. et al. J Biol Chem (2016) 291:16292-16306. DOI 10.1074/jbc.M116.726547 · PubMed
Other PDB entries of the same protein (UniProt O43602 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5IN7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.