5IUE: PDB entry 5IUE

Human leukocyte antigen F (HLA-F) presents peptides and regulates immunity through interactions with NK-cell receptors. Determined by X-ray diffraction at 2.62 Å resolution. Released 14 Jun 2017.

Method: X-ray diffraction
Resolution: 2.62 Å
Organisms: Homo sapiens, Trichoplusia ni
Chains: 12
Atoms: 12,729
Mol. weight: 215.83 kDa
Ligands: NAG
Released: 14 Jun 2017

Explore 5IUE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IUE contains 46 α-helices and 120 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-14	12	1
β-strand	18-28	11	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-103	10	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	140-149	10
α-helix	152-158	7
α-helix	159-164	6
α-helix	165-174	10
α-helix	176-179	4
β-strand	183	1	2
α-helix	184-185	2
β-strand	186-193	8	3
β-strand	198-208	11	3
β-strand	209	1	2
β-strand	214-219	6	4
β-strand	222-223	2	4
β-strand	228-230	3	3
β-strand	234-235	2	3
β-strand	241-250	10	3
α-helix	254-256	3
β-strand	257-262	6	4
β-strand	270-272	3	4

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
α-helix	4-5	2
β-strand	6-11	6	6
β-strand	21-30	10	6
β-strand	31	1	5
β-strand	35-41	7	7
β-strand	44-45	2	7
β-strand	50-51	2	6
β-strand	55-56	2	6
β-strand	62-70	9	6
β-strand	78-84	7	7
β-strand	91-94	4	7

Chain E: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	8
α-helix	19-20	2
β-strand	21-28	8	8
β-strand	31-37	7	8
β-strand	46-47	2	8
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-103	10	8
β-strand	109-118	10	8
β-strand	121-126	6	8
β-strand	133-135	3	8
α-helix	140-150	11
α-helix	152-158	7
α-helix	159-164	6
α-helix	165-174	10
α-helix	176-179	4
β-strand	183	1	9
α-helix	184-185	2
β-strand	186-193	8	10
β-strand	198-208	11	10
β-strand	209	1	9
β-strand	214-219	6	11
β-strand	222-223	2	11
β-strand	228-230	3	10
β-strand	234-235	2	10
β-strand	241-250	10	10
α-helix	254-256	3
β-strand	257-262	6	11
β-strand	270-272	3	11

Chain F: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	12
α-helix	4-5	2
β-strand	6-11	6	13
β-strand	21-30	10	13
β-strand	31	1	12
β-strand	36-41	6	14
β-strand	44-45	2	14
β-strand	50-51	2	13
β-strand	55-56	2	13
β-strand	62-70	9	13
β-strand	78-83	6	14
β-strand	91-94	4	14

Chain G: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	15
α-helix	20	1
β-strand	21-28	8	15
β-strand	31-37	7	15
β-strand	46-47	2	15
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-103	10	15
β-strand	109-118	10	15
β-strand	121-126	6	15
β-strand	133-135	3	15
α-helix	138-149	12
α-helix	152-158	7
α-helix	159-164	6
α-helix	165-174	10
α-helix	176-179	4
β-strand	183	1	16
α-helix	184-185	2
β-strand	186-195	10	17
β-strand	198-208	11	17
β-strand	209	1	16
β-strand	214-219	6	11
β-strand	222-223	2	11
α-helix	225-227	3
β-strand	229-230	2	17
β-strand	234-235	2	17
β-strand	241-249	9	17
α-helix	254-256	3
β-strand	257-262	6	11
β-strand	270-272	3	11

Chain H: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	18
α-helix	4-5	2
β-strand	6-11	6	19
β-strand	21-30	10	19
β-strand	31	1	18
β-strand	36-41	6	20
β-strand	44-45	2	20
β-strand	50-51	2	19
β-strand	55-56	2	19
β-strand	62-70	9	19
β-strand	78-83	6	20
α-helix	90	1
β-strand	91-94	4	20

Chain I: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	21
α-helix	20	1
β-strand	21-28	8	21
β-strand	31-37	7	21
β-strand	46-47	2	21
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-103	10	21
β-strand	109-118	10	21
β-strand	121-126	6	21
β-strand	133-135	3	21
α-helix	138-150	13
α-helix	152-159	8
α-helix	160-164	5
α-helix	165-174	10
α-helix	176-179	4
β-strand	183	1	22
α-helix	184-185	2
β-strand	186-195	10	23
β-strand	198-208	11	23
β-strand	209	1	22
β-strand	214-219	6	4
β-strand	222-223	2	4
β-strand	229-230	2	23
β-strand	234-235	2	23
β-strand	241-250	10	23
α-helix	254-256	3
β-strand	257-262	6	4
β-strand	270-272	3	4

Chain J: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	24
α-helix	4-5	2
β-strand	6-11	6	25
β-strand	21-30	10	25
β-strand	31	1	24
β-strand	36-41	6	26
β-strand	44-45	2	26
β-strand	50-51	2	25
β-strand	55-56	2	25
β-strand	62-70	9	25
β-strand	78-83	6	26
β-strand	91-94	4	26
α-helix	95-97	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cDNA FLJ39643 fis, clone SMINT2004023, highly similar to HLA class I histocompatibility antigen,…	A, E, G, I	protein	284	Homo sapiens	P30511 (AlphaFold model)
Beta-2-microglobulin	B, F, H, J	protein	182	Homo sapiens	P61769 (AlphaFold model)
Peptide LEU-ILE-LEU-ARG-TRP-GLU-GLN-ASP	K, L, M, N	protein	8	Trichoplusia ni

Sequence of entity 1 (A, E, G, I), FASTA

>5IUE_1 cDNA FLJ39643 fis, clone SMINT2004023, highly similar to HLA class I histocompatibility antigen, alphachain F (chains A, E, G, I)
GSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYW
EWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDG
KDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQ
RADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGT
FQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPI

Sequence of entity 2 (B, F, H, J), FASTA

>5IUE_2 Beta-2-microglobulin (chains B, F, H, J)
MLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADLHHHHHHHHGSGGLEVLFQG
PEFGGSADPIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEH
SDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMGGGGSGGSGSGG
GS

Sequence of entity 3 (K, L, M, N), FASTA

>5IUE_3 Peptide LEU-ILE-LEU-ARG-TRP-GLU-GLN-ASP (chains K, L, M, N)
LILRWEQD

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Human Leukocyte Antigen F Presents Peptides and Regulates Immunity through Interactions with NK Cell Receptors. Dulberger, C.L., McMurtrey, C.P., Holzemer, A. et al. Immunity (2017) 46:1018-1029.e7. DOI 10.1016/j.immuni.2017.06.002 · PubMed

Other PDB entries of the same protein (UniProt P30511 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5KNM 3.3 Å, Human leukocyte antigen F (HLA-F) presents peptides and regulates immunity through…

Browse structure collections

About this viewer

MolViewer shows 5IUE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.