5IX2: Mouse Morc3 ATPase-CW cassette

Crystal structure of mouse Morc3 ATPase-CW cassette in complex with AMPPNP and unmodified H3 peptide. Determined by X-ray diffraction at 2.9 Å resolution. Released 17 Aug 2016.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Mus musculus
Chains: 4
Atoms: 7,049
Mol. weight: 111.79 kDa
Ligands: ZN, ANP, MG
Released: 17 Aug 2016

Explore 5IX2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IX2 contains 33 α-helices and 64 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	14	1	2
α-helix	18-21	4
α-helix	29-41	13
β-strand	49-57	9	3
β-strand	60-67	8	3
α-helix	74-80	7
β-strand	83	1	4
β-strand	91	1	5
β-strand	94	1	5
α-helix	103-111	9
β-strand	112-121	10	3
β-strand	124-131	8	3
α-helix	132-138	7
β-strand	144	1	6
β-strand	147-151	5	3
β-strand	156	1	3
α-helix	159-172	14
α-helix	178-185	8
β-strand	192-201	10	3
β-strand	203-204	2	7
β-strand	207-208	2	7
β-strand	211	1	8
β-strand	220	1	8
α-helix	246-249	4
β-strand	250	1	8
α-helix	251-256	6
β-strand	259	1	9
β-strand	265-268	4	3
β-strand	271-272	2	3
β-strand	282-290	9	9
β-strand	299-306	8	9
β-strand	314-319	6	9
β-strand	322-328	7	9
β-strand	343-348	6	9
β-strand	354	1	10
β-strand	361	1	10
α-helix	365-390	26
α-helix	405-407	3
β-strand	408-412	5	11
β-strand	413	1	12
β-strand	419-422	4	11
β-strand	433	1	12
α-helix	435-437	3
α-helix	441-443	3
α-helix	449-454	6

Chain B: 19 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	9-10	2
β-strand	11	1	6
α-helix	12	1
β-strand	14	1	4
α-helix	17-22	6
α-helix	23-25	3
α-helix	29-41	13
β-strand	49-57	9	13
β-strand	60-67	8	13
α-helix	74-80	7
β-strand	83	1	2
β-strand	91	1	14
β-strand	94	1	14
α-helix	103-111	9
β-strand	112-121	10	13
β-strand	125-131	7	13
α-helix	132-137	6
β-strand	144	1	1
β-strand	147-150	4	13
β-strand	156-157	2	13
α-helix	159-172	14
α-helix	178-186	9
β-strand	192-201	10	13
β-strand	203-204	2	15
β-strand	207-208	2	15
β-strand	211	1	16
β-strand	220	1	16
α-helix	221-223	3
α-helix	246-249	4
β-strand	250	1	16
α-helix	251-257	7
β-strand	259	1	17
β-strand	265-268	4	13
β-strand	271-272	2	13
α-helix	278-281	4
β-strand	282-290	9	17
β-strand	299-306	8	17
β-strand	314-319	6	17
β-strand	322-328	7	17
α-helix	332-335	4
β-strand	343-348	6	17
β-strand	354	1	18
β-strand	361	1	18
α-helix	365-385	21
α-helix	405-407	3
β-strand	408-412	5	19
β-strand	419-422	4	19
α-helix	435-437	3
α-helix	449-453	5

Chains P and Q: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-6	4	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MORC family CW-type zinc finger protein 3	A, B	protein	451	Mus musculus	F7BJB9 (AlphaFold model)
peptide from Histone H3.1	P, Q	protein	32	Mus musculus	P68433 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5IX2_1 MORC family CW-type zinc finger protein 3 (chains A, B)
STGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVISDHICLTF
TDNGNGMTADKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAMVFTKNGETM
SVGFLSQTYLEVIKAEHVVVPIVTFNKHRQMINLTESKASLAAILEHSLFSTEQKLLAEL
NAIMGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDETAGRKGYKKQERMDQIAP
ESDYSLRAYCSILYLKPRMQIIIRGQKVKTQLVSKSLAYIERDVYRPKFLTRTVRITFGF
NCRNKDHYGIMMYHKNRLIKAYEKVGCQLKANNMGVGVVGIIECNFLKPTHNKQDFDYTN
EYRLTILALGEKLNDYWNEMKVKKNAEYPVNLPVEDIQKRPDQTWVQCDACLKWRKLPDG
IDQLPEKWYCSNNPDPQFRNCEVPEEPEDED

Sequence of entity 2 (P, Q), FASTA

>5IX2_2 peptide from Histone H3.1 (chains P, Q)
ARTKQTARKSTGGKAPRKQLATKAARKSAPAT

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2
MG	Magnesium ion	Mg	2

Primary citation

Mouse MORC3 is a GHKL ATPase that localizes to H3K4me3 marked chromatin. Li, S., Yen, L., Pastor, W.A. et al. Proc Natl Acad Sci U S A (2016) 113:E5108-E5116. DOI 10.1073/pnas.1609709113 · PubMed

Other PDB entries of the same protein (UniProt F7BJB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IX1 2.6 Å, Crystal structure of mouse Morc3 ATPase-CW cassette in complex with AMPPNP and H3K4me3…

Browse structure collections

About this viewer

MolViewer shows 5IX2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.