5JD0: ARAP3 RhoGAP domain

crystal structure of ARAP3 RhoGAP domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 22 Jun 2016.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,177
Mol. weight: 48.37 kDa
Released: 22 Jun 2016

Explore 5JD0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JD0 contains 26 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	909-911	3
β-strand	914	1	1
β-strand	920	1	1
α-helix	921-933	13
α-helix	947-960	14
α-helix	961-963	3
α-helix	973-986	14
α-helix	997-1004	8
α-helix	1009-1020	12
α-helix	1025-1043	19
α-helix	1045-1048	4
α-helix	1052-1064	13
α-helix	1071-1082	12
α-helix	1084-1087	4
α-helix	1092-1106	15

Chain B: 13 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	909-911	3
β-strand	914	1	2
β-strand	920	1	2
α-helix	921-933	13
α-helix	947-960	14
α-helix	961-963	3
β-strand	968	1	3
β-strand	971	1	3
α-helix	973-986	14
α-helix	997-1004	8
α-helix	1009-1020	12
α-helix	1025-1043	19
α-helix	1045-1048	4
α-helix	1052-1063	12
α-helix	1071-1082	12
α-helix	1084-1087	4
α-helix	1092-1104	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3	A, B	protein	211	Homo sapiens	Q8WWN8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5JD0_1 Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 (chains A, B)
MGHHHHHHMGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAE
FRRDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKY
KDVIGCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRV
LQELIDGYISVFDIDSDQVAQIDLEVSLITT

Primary citation

Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3. Bao, H., Li, F., Wang, C. et al. J Biol Chem (2016) 291:16709-16719. DOI 10.1074/jbc.M116.736140 · PubMed

Other PDB entries of the same protein (UniProt Q8WWN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A9B 2.0 Å, Crystal structure of Shank1 PDZ domain with ARAP3-derived peptide
7YIR 2.1 Å, Crystal structure of N-terminal PH domain of ARAP3 protein from human
5JCP 2.1 Å, RhoGAP domain of ARAP3 in complex with RhoA in the transition state
7YIS 3.3 Å, Crystal structure of N-terminal PH domain of ARAP3 protein in complex with inositol…
2KG5 NMR Solution structure of ARAP3-SAM
2LNW Identification and structural basis for a novel interaction between Vav2 and Arap3

Browse structure collections

About this viewer

MolViewer shows 5JD0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.