Phosphorylated Rotavirus NSP1 in complex with IRF-3. Determined by X-ray diffraction at 1.72 Å resolution. Released 15 Jun 2016.
Explore 5JEO in 3D Show helices and sheets RCSB PDB PDBe
5JEO contains 8 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 191-196 | 6 | |
| β-strand | 202 | 1 | 2 |
| β-strand | 204-210 | 7 | 3 |
| β-strand | 213-220 | 8 | 3 |
| β-strand | 226-229 | 4 | 4 |
| β-strand | 241-244 | 4 | 4 |
| α-helix | 245-247 | 3 | |
| α-helix | 255-266 | 12 | |
| β-strand | 272-277 | 6 | 4 |
| β-strand | 280-285 | 6 | 4 |
| β-strand | 289 | 1 | 1 |
| β-strand | 291-296 | 6 | 3 |
| β-strand | 309-310 | 2 | 3 |
| β-strand | 313 | 1 | 4 |
| β-strand | 317-321 | 5 | 4 |
| α-helix | 322-333 | 12 | |
| α-helix | 338-341 | 4 | |
| β-strand | 343-348 | 6 | 3 |
| α-helix | 358-360 | 3 | |
| β-strand | 364-369 | 6 | 3 |
| α-helix | 370-382 | 13 | |
| β-strand | 388-391 | 4 | 5 |
| β-strand | 395 | 1 | 2 |
| β-strand | 401-404 | 4 | 5 |
| α-helix | 405-417 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 488 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rotavirus NSP1 peptide | B | protein | 19 | Rotavirus A | Q99FX5 |
| Interferon regulatory factor 3 | A | protein | 242 | Homo sapiens | Q14653 (AlphaFold model) |
>5JEO_1 Rotavirus NSP1 peptide (chains B) STLTEEFELLISNSEDDWE
>5JEO_2 Interferon regulatory factor 3 (chains A) SEFENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTL PDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGH GPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMV KVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPG ES
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 3 |
Structural basis for concerted recruitment and activation of IRF-3 by innate immune adaptor proteins. Zhao, B., Shu, C., Gao, X. et al. Proc Natl Acad Sci U S A (2016) 113:E3403-E3412. DOI 10.1073/pnas.1603269113 · PubMed
Other PDB entries of the same protein (UniProt Q99FX5), best resolution first:
MolViewer shows 5JEO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.