5JIY: Histone-lysine N-methyltransferase EHMT2

Name: PDB 5JIY: Structure of G9a SET-domain with Histone H3K9norLeucine mutant peptide and bound S-adenosylmethionine
Published: 2016-09-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Structure of G9a SET-domain with Histone H3K9norLeucine mutant peptide and bound S-adenosylmethionine. Determined by X-ray diffraction at 1.48 Å resolution. Released 14 Sept 2016.

Method: X-ray diffraction
Resolution: 1.48 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,704
Mol. weight: 66.89 kDa
Ligands: SAM, ZN
Released: 14 Sept 2016

Explore 5JIY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JIY contains 22 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	917-919	3
β-strand	920-923	4	1
β-strand	937-939	3	1
β-strand	951-952	2	2
β-strand	957-958	2	2
β-strand	967	1	3
α-helix	968-970	3
α-helix	986-989	4
β-strand	996	1	4
β-strand	1002	1	4
α-helix	1011-1013	3
β-strand	1014-1015	2	5
α-helix	1032-1034	3
β-strand	1040-1044	5	1
β-strand	1050-1054	5	1
β-strand	1058	1	6
β-strand	1063-1067	5	5
β-strand	1069-1073	5	2
α-helix	1074-1077	4
β-strand	1086-1088	3	2
β-strand	1097-1105	9	2
α-helix	1107-1110	4
α-helix	1111	1
β-strand	1112-1113	2	7
β-strand	1119-1125	7	5
β-strand	1135-1140	6	5
β-strand	1144	1	6
α-helix	1148	1
β-strand	1149	1	1
α-helix	1150	1
β-strand	1151-1152	2	7
α-helix	1156-1162	7
α-helix	1179-1187	9

Chain B: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	921-923	3	8
β-strand	937-938	2	8
β-strand	951-952	2	3
β-strand	957-958	2	3
β-strand	967	1	2
α-helix	968-970	3
α-helix	986-989	4
β-strand	996	1	9
β-strand	1002	1	9
α-helix	1011-1013	3
β-strand	1014-1015	2	10
α-helix	1032-1034	3
β-strand	1040-1044	5	8
β-strand	1050-1054	5	8
β-strand	1058	1	11
β-strand	1063-1067	5	10
β-strand	1069-1073	5	3
α-helix	1074-1077	4
β-strand	1086-1089	4	3
β-strand	1097-1105	9	3
α-helix	1107-1110	4
α-helix	1111	1
β-strand	1112-1113	2	12
β-strand	1119-1125	7	10
β-strand	1135-1140	6	10
β-strand	1144	1	11
α-helix	1148	1
β-strand	1149-1150	2	8
β-strand	1151-1152	2	12
α-helix	1156-1162	7
α-helix	1179-1186	8

Chains F and G: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	9	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase EHMT2	A, B	protein	274	Homo sapiens	Q96KQ7 (AlphaFold model)
Histone H3.1 mutant peptide with H3K9nor-leucine	F, G	protein	11	Homo sapiens	P68431 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5JIY_1 Histone-lysine N-methyltransferase EHMT2 (chains A, B)
IRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCT
CVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSG
IKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDGE
VYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYG
DRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRL

Sequence of entity 2 (F, G), FASTA

>5JIY_2 Histone H3.1 mutant peptide with H3K9nor-leucine (chains F, G)
TKQTARLSTGG

Ligands and cofactors

ID	Name	Formula	Copies
SAM	S-adenosylmethionine	C15 H22 N6 O5 S	2
ZN	Zinc ion	Zn	8

Primary citation

S-adenosyl methionine is necessary for inhibition of the methyltransferase G9a by the lysine 9 to methionine mutation on histone H3. Jayaram, H., Hoelper, D., Jain, S.U. et al. Proc Natl Acad Sci U S A (2016) 113:6182-6187. DOI 10.1073/pnas.1605523113 · PubMed

Other PDB entries of the same protein (UniProt Q96KQ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VSC 1.4 Å, Structure of human G9a SET-domain (EHMT2) in complex with inhibitor 13
7XUD 1.45 Å, Structure of G9a in complex with compound 26a
7X73 1.49 Å, Structure of G9a in complex with RK-701
8Z7C 1.52 Å, Structure of G9a in complex with compound 7i
8Z7E 1.54 Å, Structure of G9a in complex with compound 9b
8Z7D 1.58 Å, Structure of G9a in complex with compound 9a
5VSE 1.6 Å, Structure of human G9a SET-domain (EHMT2) in complex with inhibitor 17:…
5JHN 1.67 Å, Structure of G9a SET-domain with Histone H3K9Ala mutant peptide and bound…
7XUC 1.67 Å, Structure of G9a in complex with compound 11a
3K5K 1.7 Å, Discovery of a 2,4-Diamino-7-aminoalkoxy-quinazoline as a Potent Inhibitor of Histone…
5T0K 1.7 Å, Structure of G9a SET-domain with H3K9M mutant peptide and SAM
5JJ0 1.72 Å, Structure of G9a SET-domain with Histone H3K9M peptide and excess SAH

Browse structure collections

About this viewer

MolViewer shows 5JIY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.