5JOH: CSN5(2-257)

Crystal structure of CSN5(2-257) in complex with CNS5i-1b. Determined by X-ray diffraction at 1.99 Å resolution. Released 2 Nov 2016.

Method: X-ray diffraction
Resolution: 1.99 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,825
Mol. weight: 29.5 kDa
Ligands: 6M3, ZN
Released: 2 Nov 2016

Explore 5JOH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JOH contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	6-42	37
α-helix	44-46	3
β-strand	54-58	5	1
α-helix	59-71	13
β-strand	78-86	9	1
β-strand	89-97	9	1
α-helix	111-126	16
β-strand	132-139	8	1
α-helix	149-161	13
β-strand	166-170	5	1
β-strand	183-188	6	1
α-helix	189-190	2
α-helix	211-217	7
β-strand	221-223	3	1
β-strand	225-229	5	1
α-helix	233-235	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
COP9 signalosome complex subunit 5	A	protein	257	Homo sapiens	Q92905 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JOH_1 COP9 signalosome complex subunit 5 (chains A)
GAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL
ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK
VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL
LWNKYWVNTLSSSSLLT

Ligands and cofactors

ID	Name	Formula	Copies
6M3	2'-chloro-6-[(5S,6S)-6-hydroxy-6,7,8,9-tetrahydro-5H-imidazo[1,5-a]azepin-5-yl]…	C21 H18 Cl N3 O	1
ZN	Zinc ion	Zn	1

Water and common crystallization additives (MPD) are not listed.

Primary citation

Targeted inhibition of the COP9 signalosome for treatment of cancer. Schlierf, A., Altmann, E., Quancard, J. et al. Nat Commun (2016) 7:13166-13166. DOI 10.1038/ncomms13166 · PubMed

Other PDB entries of the same protein (UniProt Q92905 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M5Q 2.2 Å, COPS5(2-257) in complex with a azaindole (compound 4)
5JOG 2.46 Å, Crystal structure of CSN5(2-257) in complex with CNS5i-3
4F7O 2.6 Å, Crystal structure of CSN5
9QO4 2.95 Å, Dissociation-state-3 of 9-subunit CSN and SCF (SKP1-SKP2-CKS1) complex
9EFQ 2.96 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-2
9PH4 3.0 Å, Cryo-EM structure of COP9 signalosome in complex with CSN5i-1a
9QO6 3.0 Å, 9-subunit COP9 signalosome complex
9EFV 3.03 Å, Cryo-EM structure of CSN-N8CUL1 in complex with CSN5i-3
9EFM 3.16 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-1
9QO1 3.23 Å, Activated 9-subunit COP9 signalosome and neddylated SCF (SKP1-SKP2-CKS1) complex structure
9QO0 3.26 Å, Pre-activated 9-subunit COP9 signalosome and neddylated SCF (Skp1-Skp2-Cks1) complex…
9E77 3.3 Å, Cryo-EM structure of CSN-N8 in complex with CSN5i-3

Browse structure collections

About this viewer

MolViewer shows 5JOH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.