Crystal structure of CSN5(2-257) in complex with CNS5i-1b. Determined by X-ray diffraction at 1.99 Å resolution. Released 2 Nov 2016.
Explore 5JOH in 3D Show helices and sheets RCSB PDB PDBe
5JOH contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-42 | 37 | |
| α-helix | 44-46 | 3 | |
| β-strand | 54-58 | 5 | 1 |
| α-helix | 59-71 | 13 | |
| β-strand | 78-86 | 9 | 1 |
| β-strand | 89-97 | 9 | 1 |
| α-helix | 111-126 | 16 | |
| β-strand | 132-139 | 8 | 1 |
| α-helix | 149-161 | 13 | |
| β-strand | 166-170 | 5 | 1 |
| β-strand | 183-188 | 6 | 1 |
| α-helix | 189-190 | 2 | |
| α-helix | 211-217 | 7 | |
| β-strand | 221-223 | 3 | 1 |
| β-strand | 225-229 | 5 | 1 |
| α-helix | 233-235 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| COP9 signalosome complex subunit 5 | A | protein | 257 | Homo sapiens | Q92905 (AlphaFold model) |
>5JOH_1 COP9 signalosome complex subunit 5 (chains A) GAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL LWNKYWVNTLSSSSLLT
| ID | Name | Formula | Copies |
|---|---|---|---|
| 6M3 | 2'-chloro-6-[(5S,6S)-6-hydroxy-6,7,8,9-tetrahydro-5H-imidazo[1,5-a]azepin-5-yl]… | C21 H18 Cl N3 O | 1 |
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (MPD) are not listed.
Targeted inhibition of the COP9 signalosome for treatment of cancer. Schlierf, A., Altmann, E., Quancard, J. et al. Nat Commun (2016) 7:13166-13166. DOI 10.1038/ncomms13166 · PubMed
Other PDB entries of the same protein (UniProt Q92905 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5JOH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.