5JVM: PDB entry 5JVM

The neck-linker and alpha 7 helix of Mus musculus KIF3C. Determined by X-ray diffraction at 1.57 Å resolution. Released 3 Aug 2016.

Method: X-ray diffraction
Resolution: 1.57 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,638
Mol. weight: 19.3 kDa
Ligands: MG
Released: 3 Aug 2016

Explore 5JVM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JVM contains 5 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-55	50
α-helix	62-71	10

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	6-55	50
α-helix	58-60	3
α-helix	62-72	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimera protein of Kinesin-like protein KIF3C and Microtubule-associated protein RP/EB family…	A, B	protein	82	Mus musculus, Homo sapiens	O35066 (AlphaFold model), Q15691 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5JVM_1 Chimera protein of Kinesin-like protein KIF3C and Microtubule-associated protein RP/EB family member 1 (chains A, B)
LSNEDPKDTLLREFQEEIARLKAQLEKKGMLVEDLEKERDFYFGKLRNIELICQENEGEN
DPVLQRIVDILYATDEGFVIPD

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Family-specific Kinesin Structures Reveal Neck-linker Length Based on Initiation of the Coiled-coil. Phillips, R.K., Peter, L.G., Gilbert, S.P. et al. J Biol Chem (2016) 291:20372-20386. DOI 10.1074/jbc.M116.737577 · PubMed

Browse structure collections

About this viewer

MolViewer shows 5JVM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.