The neck-linker + DAL and alpha 7 helix of Drosophila melanogaster Kinesin-1 fused to EB1. Determined by X-ray diffraction at 2.25 Å resolution. Released 3 Aug 2016.
Explore 5JVS in 3D Show helices and sheets RCSB PDB PDBe
5JVS contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-62 | 47 | |
| α-helix | 69-78 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chimera protein of Kinesin heavy chain and Microtubule-associated protein RP/EB family member 1 | A | protein | 88 | Drosophila melanogaster, Homo sapiens | P17210 (AlphaFold model), Q15691 (AlphaFold model) |
>5JVS_1 Chimera protein of Kinesin heavy chain and Microtubule-associated protein RP/EB family member 1 (chains A) LSKNVVAVNEELTDALAEEWKRRYEKEKEKNARLKGKVEDLEKERDFYFGKLRNIELICQ ENEGENDPVLQRIVDILYATDEGFVIPD
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (EDO) are not listed.
Family-specific Kinesin Structures Reveal Neck-linker Length Based on Initiation of the Coiled-coil. Phillips, R.K., Peter, L.G., Gilbert, S.P. et al. J Biol Chem (2016) 291:20372-20386. DOI 10.1074/jbc.M116.737577 · PubMed
Other PDB entries of the same protein (UniProt P17210 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5JVS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.