5JXB: PSD-95 extended PDZ3

PSD-95 extended PDZ3 in complex with SynGAP PBM. Determined by X-ray diffraction at 2.9 Å resolution. Released 28 Sept 2016.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 1,781
Mol. weight: 26.82 kDa
Released: 28 Sept 2016

Explore 5JXB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JXB contains 6 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	306-308	3
β-strand	309-314	6	1
β-strand	322-325	4	1
β-strand	334-338	5	1
β-strand	354-359	6	1
β-strand	362-363	2	1
α-helix	369-378	10
β-strand	382-389	8	1
α-helix	391-408	18
β-strand	423-425	3	1

Chain C: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	309-314	6	2
β-strand	323-326	4	2
β-strand	327	1	3
β-strand	329	1	3
β-strand	333-335	3	2
α-helix	343-347	5
β-strand	354-359	6	2
β-strand	362-363	2	2
α-helix	369-378	10
β-strand	382-389	8	2
α-helix	391-408	18
β-strand	424-425	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 4,SynGAP	A, C	protein	123	Homo sapiens, Mus musculus	J3QQ18, P78352 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5JXB_1 Disks large homolog 4,SynGAP (chains A, C)
EFREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVD
LRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNGSGSGSFPPWVQQ
TRV

Primary citation

Phase Transition in Postsynaptic Densities Underlies Formation of Synaptic Complexes and Synaptic Plasticity. Zeng, M., Shang, Y., Araki, Y. et al. Cell (2016) 166:1163-1175.e12. DOI 10.1016/j.cell.2016.07.008 · PubMed

Browse structure collections

About this viewer

MolViewer shows 5JXB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.