Homo sapiens CCCTC-binding factor (CTCF) ZnF5-8 and DNA complex structure in space group P41212. Determined by X-ray diffraction at 2.29 Å resolution. Released 24 May 2017.
Explore 5K5J in 3D Show helices and sheets RCSB PDB PDBe
5K5J contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 379-380 | 2 | 1 |
| β-strand | 387-388 | 2 | 1 |
| α-helix | 391-402 | 12 | |
| β-strand | 407-408 | 2 | 2 |
| β-strand | 415-416 | 2 | 2 |
| α-helix | 419-430 | 12 | |
| β-strand | 437-438 | 2 | 3 |
| β-strand | 445-446 | 2 | 3 |
| α-helix | 449-459 | 11 | |
| β-strand | 467-468 | 2 | 4 |
| β-strand | 475-476 | 2 | 4 |
| α-helix | 479-488 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcriptional repressor CTCF | A | protein | 117 | Homo sapiens | P49711 (AlphaFold model) |
| DNA (5'-d(*cp*cp*cp*tp*gp*cp*tp*gp*gp*cp*ap*ap*c)-3') | B | DNA | 13 | synthetic construct | |
| DNA (5'-d(*tp*tp*gp*cp*cp*ap*gp*cp*ap*gp*gp*gp*g)-3') | C | DNA | 13 | synthetic construct |
>5K5J_1 Transcriptional repressor CTCF (chains A) GPLGSPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTE NVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSH
>5K5J_2 DNA (5'-D(*CP*CP*CP*TP*GP*CP*TP*GP*GP*CP*AP*AP*C)-3') (chains B) CCCTGCTGGCAAC
>5K5J_3 DNA (5'-D(*TP*TP*GP*CP*CP*AP*GP*CP*AP*GP*GP*GP*G)-3') (chains C) TTGCCAGCAGGGG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Water and common crystallization additives (ACT, SO4) are not listed.
Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA. Hashimoto, H., Wang, D., Horton, J.R. et al. Mol Cell (2017) 66:711-720.e3. DOI 10.1016/j.molcel.2017.05.004 · PubMed
Other PDB entries of the same protein (UniProt P49711 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5K5J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.