horse liver S48T alcohol dehydrogenase complexed with NAD and pentafluorobenzyl alcohol. Determined by X-ray diffraction at 1.1 Å resolution. Released 29 Jun 2016.
Explore 5KCP in 3D Show helices and sheets RCSB PDB PDBe
5KCP contains 45 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-14 | 8 | 1 |
| β-strand | 22-28 | 7 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 35-44 | 10 | 2 |
| α-helix | 47-54 | 8 | |
| β-strand | 63-64 | 2 | 1 |
| β-strand | 69-76 | 8 | 2 |
| β-strand | 88-91 | 4 | 2 |
| α-helix | 101-104 | 4 | |
| β-strand | 130-132 | 3 | 1 |
| β-strand | 135-138 | 4 | 1 |
| β-strand | 147 | 1 | 1 |
| β-strand | 149-153 | 5 | 2 |
| α-helix | 154-156 | 3 | |
| β-strand | 157-159 | 3 | 2 |
| α-helix | 166-169 | 4 | |
| α-helix | 170-173 | 4 | |
| α-helix | 175-181 | 7 | |
| α-helix | 182-187 | 6 | |
| β-strand | 194-198 | 5 | 3 |
| α-helix | 202-213 | 12 | |
| β-strand | 218-222 | 5 | 3 |
| α-helix | 226-228 | 3 | |
| α-helix | 229-235 | 7 | |
| β-strand | 239-241 | 3 | 3 |
| α-helix | 243-245 | 3 | |
| α-helix | 250-257 | 8 | |
| β-strand | 262 | 1 | 4 |
| β-strand | 264-267 | 4 | 3 |
| α-helix | 272-281 | 10 | |
| β-strand | 282 | 1 | 4 |
| β-strand | 288-291 | 4 | 3 |
| α-helix | 294-296 | 3 | |
| α-helix | 299-300 | 2 | |
| β-strand | 301-303 | 3 | 5 |
| α-helix | 306-309 | 4 | |
| β-strand | 313-316 | 4 | 3 |
| α-helix | 319-321 | 3 | |
| α-helix | 324-336 | 13 | |
| α-helix | 343-345 | 3 | |
| β-strand | 346-351 | 6 | 2 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-363 | 9 | |
| β-strand | 369-373 | 5 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6 | 1 | |
| β-strand | 7-13 | 7 | 6 |
| β-strand | 14 | 1 | 7 |
| α-helix | 20-21 | 2 | |
| β-strand | 22-28 | 7 | 6 |
| α-helix | 29-31 | 3 | |
| β-strand | 35-44 | 10 | 8 |
| α-helix | 47-54 | 8 | |
| β-strand | 63 | 1 | 7 |
| β-strand | 69-76 | 8 | 8 |
| β-strand | 88-91 | 4 | 8 |
| α-helix | 101-104 | 4 | |
| β-strand | 130-132 | 3 | 6 |
| β-strand | 135-137 | 3 | 6 |
| β-strand | 138 | 1 | 7 |
| β-strand | 147 | 1 | 6 |
| β-strand | 149-153 | 5 | 8 |
| α-helix | 154-156 | 3 | |
| β-strand | 157-159 | 3 | 8 |
| α-helix | 166-169 | 4 | |
| α-helix | 170-173 | 4 | |
| α-helix | 175-181 | 7 | |
| α-helix | 182-187 | 6 | |
| β-strand | 194-198 | 5 | 3 |
| α-helix | 202-213 | 12 | |
| β-strand | 218-222 | 5 | 3 |
| α-helix | 226-228 | 3 | |
| α-helix | 229-235 | 7 | |
| β-strand | 239-241 | 3 | 3 |
| α-helix | 243-245 | 3 | |
| α-helix | 250-257 | 8 | |
| β-strand | 262 | 1 | 9 |
| β-strand | 264-267 | 4 | 3 |
| α-helix | 272-281 | 10 | |
| β-strand | 282 | 1 | 9 |
| β-strand | 288-291 | 4 | 3 |
| α-helix | 294-296 | 3 | |
| β-strand | 301-303 | 3 | 5 |
| α-helix | 306-309 | 4 | |
| β-strand | 313-316 | 4 | 3 |
| α-helix | 319-321 | 3 | |
| α-helix | 324-336 | 13 | |
| α-helix | 343-345 | 3 | |
| β-strand | 346-351 | 6 | 8 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-363 | 9 | |
| β-strand | 369-373 | 5 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alcohol dehydrogenase E chain | A, B | protein | 374 | Equus caballus | P00327 (AlphaFold model) |
>5KCP_1 Alcohol dehydrogenase E chain (chains A, B) STAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRTDDHVVSGTLVTP LPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMPR GTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGY GSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATEC VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQN LSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFD LLRSGESIRTILTF
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
| NAJ | Nicotinamide-adenine-dinucleotide (acidic form) | C21 H27 N7 O14 P2 | 2 |
| MRD | (4R)-2-methylpentane-2,4-diol | C6 H14 O2 | 4 |
| PFB | 2,3,4,5,6-pentafluorobenzyl alcohol | C7 H3 F5 O | 4 |
Inversion of substrate stereoselectivity of horse liver alcohol dehydrogenase by substitutions of Ser-48 and Phe-93. Kim, K., Plapp, B.V. Chem Biol Interact (2017) 276:77-87. DOI 10.1016/j.cbi.2016.12.016 · PubMed
Other PDB entries of the same protein (UniProt P00327 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5KCP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.