5KHG: HCN2 CNBD

HCN2 CNBD in complex with cytidine-3', 5'-cyclic monophosphate (cCMP). Determined by X-ray diffraction at 2.24 Å resolution. Released 14 Sept 2016.

Method: X-ray diffraction
Resolution: 2.24 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,645
Mol. weight: 24.19 kDa
Ligands: CC7
Released: 14 Sept 2016

Explore 5KHG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5KHG contains 10 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	444-462	19
α-helix	467-481	15
α-helix	488-493	6
α-helix	497-507	11
α-helix	509-514	6
α-helix	516-519	4
α-helix	523-530	8
β-strand	534-538	5	1
β-strand	543-545	3	2
β-strand	553-559	7	1
β-strand	561-565	5	2
β-strand	572-575	4	2
β-strand	579-580	2	1
α-helix	582-587	6
β-strand	594-597	4	2
β-strand	601-607	7	1
α-helix	608-616	9
α-helix	620-635	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2	A	protein	204	Mus musculus	O88703 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5KHG_1 Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 (chains A)
SNADSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPL
REEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQH
GVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYP
MMRRAFETVAIDRLDRIGKKNSIL

Ligands and cofactors

ID	Name	Formula	Copies
CC7	4-amino-1-[(2S,4aR,6R,7R,7aS)-2,7-dihydroxy-2-oxidotetrahydro-4H-furo[3,2-d][1,…	C9 H12 N3 O7 P	1

Primary citation

Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening. Ng, L.C., Putrenko, I., Baronas, V. et al. Structure (2016) 24:1629-1642. DOI 10.1016/j.str.2016.06.024 · PubMed

Other PDB entries of the same protein (UniProt O88703 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BPZ 1.65 Å, HCN2-I 443-460 E502K in the presence of cAMP
5KHH 1.77 Å, HCN2 CNBD in complex with inosine-3', 5'-cyclic monophosphate (cIMP)
1Q3E 1.9 Å, HCN2J 443-645 in the presence of cGMP
3ETQ 1.9 Å, X-ray structure of cysteine-free fragment of mHCN2 C-terminal region from amino acids…
1Q43 2.0 Å, HCN2I 443-640 in the presence of cAMP, selenomethionine derivative
5KHJ 2.01 Å, HCN2 CNBD in complex with uridine-3', 5'-cyclic monophosphate (cUMP)
5JON 2.04 Å, Crystal structure of the unliganded form of HCN2 CNBD
5KHK 2.07 Å, HCN2 CNBD in complex with 2-aminopurine riboside-3', 5'-cyclic monophosphate (2-NH2-cPuMP)
5KHI 2.1 Å, HCN2 CNBD in complex with purine riboside-3', 5'-cyclic monophosphate (cPuMP)
2Q0A 2.25 Å, Structure and rearrangements in the carboxy-terminal region of SpIH channels
1Q5O 2.3 Å, HCN2J 443-645 in the presence of cAMP, selenomethionine derivative
3FFQ 2.4 Å, HCN2I 443-640 apo-state

Browse structure collections

About this viewer

MolViewer shows 5KHG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.