5KX4: SALO

Structure of SALO. Determined by X-ray diffraction at 1.94 Å resolution. Released 27 Jul 2016.

Method: X-ray diffraction
Resolution: 1.94 Å
Organism: Lutzomyia longipalpis
Chains: 2
Atoms: 1,546
Mol. weight: 23.85 kDa
Released: 27 Jul 2016

Explore 5KX4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5KX4 contains 15 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	4-22	19
α-helix	28-31	4
α-helix	36-42	7
α-helix	44-46	3
α-helix	53-66	14
α-helix	74-84	11
α-helix	87-90	4

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	4-22	19
α-helix	28-31	4
α-helix	36-42	7
α-helix	44-46	3
α-helix	50-52	3
α-helix	53-66	14
α-helix	74-84	11
α-helix	87-90	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
10.7 kDa salivary protein	A, B	protein	101	Lutzomyia longipalpis	Q5WPZ4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5KX4_1 10.7 kDa salivary protein (chains A, B)
EFSEDCENIFHDNAYLLKLDCEAGRVDPVEYDDISDEEIYEITVDVGVSSEDQEKVAKII
RECIAQVSTQDCTKFSEIYDCYMKKKICNYYPENMHHHHHH

Primary citation

Structure of SALO, a leishmaniasis vaccine candidate from the sand fly Lutzomyia longipalpis. Asojo, O.A., Kelleher, A., Liu, Z. et al. PLoS Negl Trop Dis (2017) 11:e0005374-e0005374. DOI 10.1371/journal.pntd.0005374 · PubMed

Other PDB entries of the same protein (UniProt Q5WPZ4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EKE 3.1 Å, Structure of a C1r Zymogen Fragment Bound to SALO, Y51F Mutant
9EKD 3.28 Å, Structure of a C1r Zymogen Fragment Bound to SALO

Browse structure collections

About this viewer

MolViewer shows 5KX4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.