Structure of the crenarchaeal FtsY GTPase bound to GDP. Determined by X-ray diffraction at 2.4 Å resolution. Released 8 Jun 2016.
Explore 5L3W in 3D Show helices and sheets RCSB PDB PDBe
5L3W contains 18 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 73-79 | 7 | |
| α-helix | 80-82 | 3 | |
| α-helix | 84-86 | 3 | |
| β-strand | 88-89 | 2 | 1 |
| α-helix | 90-91 | 2 | |
| α-helix | 92-95 | 4 | |
| α-helix | 96-108 | 13 | |
| α-helix | 113-128 | 16 | |
| β-strand | 131-132 | 2 | 1 |
| α-helix | 135-155 | 21 | |
| α-helix | 162-167 | 6 | |
| β-strand | 174-179 | 6 | 2 |
| α-helix | 186-199 | 14 | |
| β-strand | 204-208 | 5 | 2 |
| α-helix | 214-226 | 13 | |
| β-strand | 230-232 | 3 | 2 |
| α-helix | 240-253 | 14 | |
| β-strand | 258-262 | 5 | 2 |
| α-helix | 271-284 | 14 | |
| β-strand | 288-294 | 7 | 2 |
| α-helix | 298-311 | 14 | |
| β-strand | 316-320 | 5 | 2 |
| α-helix | 322-324 | 3 | |
| α-helix | 329-337 | 9 | |
| α-helix | 341 | 1 | |
| β-strand | 342-346 | 5 | 2 |
| β-strand | 354-356 | 3 | 2 |
| α-helix | 359-366 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Signal recognition particle receptor FtsY | A | protein | 306 | Sulfolobus acidocaldarius | P27414 (AlphaFold model) |
>5L3W_1 Signal recognition particle receptor FtsY (chains A) HHHHHHTGQENKQENKRSFFDFLKYKTIKEDDLNDVIEELRFQLLDSDVSYEVTEKILED LKNNLIGKKVSRREEVEEIVINTLKKSITEILTKNQKTDLIEKIRSSGKKPFVIIFFGVN GVGKTTTIAKVVNMLKKNNLSTIIAASDTFRAAAQEQLAYHASKLEVQLIRGKYGADPAS VAFDAISFAKSRNIDVVLIDTAGRMHIDSDLVEELKRVLRIAKPDFRILILDSLAGSDAL EQARHFENNVGYDAVILTKVDADAKGGIALSLAYELKKPVVYMGVGQNYDDLIPFSPDWF VERIFS
| ID | Name | Formula | Copies |
|---|---|---|---|
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 1 |
Water and common crystallization additives (SO4) are not listed.
Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex. Wild, K., Bange, G., Motiejunas, D. et al. J Mol Biol (2016) 428:2880-2897. DOI 10.1016/j.jmb.2016.05.015 · PubMed
Other PDB entries of the same protein (UniProt P27414 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5L3W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.