5LF1: Proteasome subunit alpha type-2
Human 20S proteasome complex with Dihydroeponemycin at 2.0 Angstrom. Determined by X-ray diffraction at 2.0 Å resolution. Released 17 Aug 2016.
- Method
- X-ray diffraction
- Resolution
- 2.0 Å
- Organism
- Homo sapiens
- Chains
- 28
- Atoms
- 52,156
- Mol. weight
- 726.02 kDa
- Ligands
- MG, 6VC
- Released
- 17 Aug 2016
Explore 5LF1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5LF1 contains 250 α-helices and 391 β-strands across 28 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains a and M: 6 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-8 | 3 | 7 |
| β-strand | 11-16 | 6 | 8 |
| β-strand | 19-25 | 7 | 8 |
| β-strand | 28-30 | 3 | 7 |
| β-strand | 33-36 | 4 | 7 |
| β-strand | 42-46 | 5 | 7 |
| β-strand | 49-56 | 8 | 7 |
| α-helix | 57-77 | 21 | |
| α-helix | 85-101 | 17 | |
| β-strand | 108-116 | 9 | 7 |
| β-strand | 119-125 | 7 | 7 |
| β-strand | 131-133 | 3 | 7 |
| β-strand | 136-138 | 3 | 8 |
| α-helix | 142-145 | 4 | |
| α-helix | 147-156 | 10 | |
| α-helix | 162-179 | 18 | |
| β-strand | 180 | 1 | 58 |
| β-strand | 187-193 | 7 | 8 |
| β-strand | 196-203 | 8 | 8 |
| α-helix | 210-213 | 4 | |
Chain A: 10 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8 | 1 | 1 |
| α-helix | 19-29 | 11 | |
| α-helix | 32-33 | 2 | |
| β-strand | 34-38 | 5 | 2 |
| β-strand | 43-48 | 6 | 2 |
| β-strand | 56 | 1 | 3 |
| β-strand | 65-68 | 4 | 4 |
| β-strand | 71-77 | 7 | 4 |
| α-helix | 79-100 | 22 | |
| α-helix | 103-105 | 3 | |
| α-helix | 106-119 | 14 | |
| β-strand | 124 | 1 | 1 |
| β-strand | 126 | 1 | 5 |
| α-helix | 127-129 | 3 | |
| β-strand | 131-139 | 9 | 4 |
| β-strand | 142-148 | 7 | 4 |
| β-strand | 154-156 | 3 | 4 |
| β-strand | 157 | 1 | 6 |
| β-strand | 159-162 | 4 | 2 |
| α-helix | 166-174 | 9 | |
| α-helix | 183-196 | 14 | |
| β-strand | 207-213 | 7 | 2 |
| β-strand | 216-219 | 4 | 2 |
| α-helix | 220-221 | 2 | |
| α-helix | 222-231 | 10 | |
Chain b: 8 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-8 | 6 | 13 |
| β-strand | 11-16 | 6 | 13 |
| β-strand | 20-22 | 3 | 14 |
| β-strand | 25-28 | 4 | 14 |
| β-strand | 34-38 | 5 | 15 |
| β-strand | 41-47 | 7 | 15 |
| α-helix | 49-70 | 22 | |
| α-helix | 73-75 | 3 | |
| α-helix | 76-89 | 14 | |
| α-helix | 91-93 | 3 | |
| β-strand | 96-104 | 9 | 15 |
| β-strand | 108-114 | 7 | 15 |
| β-strand | 121-123 | 3 | 15 |
| β-strand | 125-128 | 4 | 13 |
| α-helix | 130-135 | 6 | |
| α-helix | 136-142 | 7 | |
| α-helix | 149-166 | 18 | |
| β-strand | 167 | 1 | 55 |
| β-strand | 174-180 | 7 | 13 |
| β-strand | 183-189 | 7 | 13 |
| α-helix | 191-193 | 3 | |
Chain B: 11 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 19-30 | 12 | |
| α-helix | 32-33 | 2 | |
| β-strand | 34-39 | 6 | 9 |
| β-strand | 42-48 | 7 | 9 |
| β-strand | 56 | 1 | 6 |
| β-strand | 65-69 | 5 | 10 |
| β-strand | 72-78 | 7 | 10 |
| α-helix | 80-101 | 22 | |
| α-helix | 104-106 | 3 | |
| α-helix | 107-123 | 17 | |
| β-strand | 124 | 1 | 11 |
| α-helix | 127-130 | 4 | |
| β-strand | 132-140 | 9 | 10 |
| β-strand | 144-150 | 7 | 10 |
| β-strand | 156-158 | 3 | 10 |
| β-strand | 159 | 1 | 12 |
| β-strand | 161-164 | 4 | 9 |
| α-helix | 168-178 | 11 | |
| α-helix | 186-200 | 15 | |
| α-helix | 208-210 | 3 | |
| β-strand | 211-219 | 9 | 9 |
| β-strand | 222-227 | 6 | 9 |
| α-helix | 228-229 | 2 | |
| α-helix | 230-245 | 16 | |
Chain C: 12 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10 | 1 | 16 |
| α-helix | 12-14 | 3 | |
| β-strand | 16 | 1 | 16 |
| α-helix | 17-27 | 11 | |
| α-helix | 30-31 | 2 | |
| β-strand | 32-36 | 5 | 17 |
| β-strand | 40-46 | 7 | 17 |
| β-strand | 54 | 1 | 12 |
| α-helix | 56-59 | 4 | |
| β-strand | 62-66 | 5 | 18 |
| β-strand | 69-75 | 7 | 18 |
| α-helix | 77-98 | 22 | |
| α-helix | 101-103 | 3 | |
| α-helix | 104-117 | 14 | |
| β-strand | 121 | 1 | 19 |
| β-strand | 124 | 1 | 11 |
| α-helix | 125-127 | 3 | |
| β-strand | 129-136 | 8 | 18 |
| β-strand | 142-147 | 6 | 18 |
| β-strand | 153-155 | 3 | 18 |
| β-strand | 156 | 1 | 20 |
| β-strand | 158-161 | 4 | 17 |
| α-helix | 165-175 | 11 | |
| α-helix | 184-198 | 15 | |
| β-strand | 206-212 | 7 | 17 |
| β-strand | 218-219 | 2 | 17 |
| α-helix | 220-221 | 2 | |
| α-helix | 222-233 | 12 | |
Chain D: 13 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14 | 1 | |
| β-strand | 15 | 1 | 21 |
| α-helix | 16 | 1 | |
| β-strand | 21 | 1 | 21 |
| α-helix | 22-31 | 10 | |
| α-helix | 35-36 | 2 | |
| β-strand | 37-42 | 6 | 22 |
| β-strand | 45-51 | 7 | 22 |
| β-strand | 59 | 1 | 20 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-71 | 5 | 23 |
| β-strand | 74-80 | 7 | 23 |
| α-helix | 82-103 | 22 | |
| α-helix | 106-108 | 3 | |
| α-helix | 109-117 | 9 | |
| β-strand | 133 | 1 | 19 |
| β-strand | 139-147 | 9 | 23 |
| β-strand | 150-156 | 7 | 23 |
| β-strand | 162-164 | 3 | 23 |
| β-strand | 165 | 1 | 24 |
| β-strand | 167-170 | 4 | 22 |
| α-helix | 174-184 | 11 | |
| α-helix | 191-205 | 15 | |
| α-helix | 209-210 | 2 | |
| β-strand | 215-220 | 6 | 22 |
| β-strand | 227-228 | 2 | 22 |
| α-helix | 229-230 | 2 | |
| α-helix | 231-240 | 10 | |
Chain E: 12 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-31 | 12 | |
| α-helix | 33-34 | 2 | |
| β-strand | 35-39 | 5 | 25 |
| β-strand | 43-49 | 7 | 25 |
| α-helix | 50-51 | 2 | |
| β-strand | 57 | 1 | 24 |
| β-strand | 63-67 | 5 | 26 |
| β-strand | 70-76 | 7 | 26 |
| α-helix | 78-99 | 22 | |
| α-helix | 102-104 | 3 | |
| α-helix | 105-117 | 13 | |
| α-helix | 118-121 | 4 | |
| β-strand | 122 | 1 | 27 |
| β-strand | 130-138 | 9 | 26 |
| β-strand | 141-147 | 7 | 26 |
| β-strand | 153-156 | 4 | 26 |
| β-strand | 158-161 | 4 | 25 |
| α-helix | 165-175 | 11 | |
| α-helix | 176-178 | 3 | |
| α-helix | 184-196 | 13 | |
| β-strand | 210-216 | 7 | 25 |
| β-strand | 219-224 | 6 | 25 |
| α-helix | 226-229 | 4 | |
| α-helix | 230-233 | 4 | |
Chains F and T: 12 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 21-31 | 11 | |
| α-helix | 34-35 | 2 | |
| β-strand | 36-41 | 6 | 28 |
| β-strand | 44-52 | 9 | 28 |
| β-strand | 58 | 1 | 26 |
| α-helix | 59 | 1 | |
| β-strand | 66-70 | 5 | 29 |
| β-strand | 73-79 | 7 | 29 |
| α-helix | 81-102 | 22 | |
| α-helix | 105-107 | 3 | |
| α-helix | 108-121 | 14 | |
| β-strand | 125 | 1 | 30 |
| β-strand | 128 | 1 | 27 |
| β-strand | 133-141 | 9 | 29 |
| β-strand | 145-151 | 7 | 29 |
| β-strand | 157-159 | 3 | 29 |
| β-strand | 160 | 1 | 31 |
| β-strand | 162-165 | 4 | 28 |
| α-helix | 169-176 | 8 | |
| α-helix | 181-183 | 3 | |
| α-helix | 186-200 | 15 | |
| β-strand | 209-217 | 9 | 28 |
| α-helix | 218-220 | 3 | |
| β-strand | 225-226 | 2 | 28 |
| α-helix | 227-228 | 2 | |
| α-helix | 229-243 | 15 | |
17 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Proteasome subunit alpha type-2 | A, O | protein | 234 | Homo sapiens | P25787 (AlphaFold model) |
| Proteasome subunit alpha type-4 | B, P | protein | 261 | Homo sapiens | P25789 (AlphaFold model) |
| Proteasome subunit alpha type-7 | C, Q | protein | 248 | Homo sapiens | O14818 (AlphaFold model) |
| Proteasome subunit alpha type-5 | D, R | protein | 241 | Homo sapiens | P28066 (AlphaFold model) |
| Proteasome subunit alpha type-1 | E, S | protein | 263 | Homo sapiens | P25786 |
| Proteasome subunit alpha type-3 | F, T | protein | 255 | Homo sapiens | P25788 |
| Proteasome subunit alpha type-6 | G, U | protein | 246 | Homo sapiens | P60900 |
| Proteasome subunit beta type-7 | H, V | protein | 234 | Homo sapiens | Q99436 |
| Proteasome subunit beta type-3 | I, W | protein | 205 | Homo sapiens | P49720 |
| Proteasome subunit beta type-2 | J, X | protein | 201 | Homo sapiens | P49721 |
| Proteasome subunit beta type-5 | K, Y | protein | 204 | Homo sapiens | P28074 |
| Proteasome subunit beta type-1 | L, Z | protein | 213 | Homo sapiens | P20618 |
2 more molecules are not listed.
Sequence of entity 1 (A, O), FASTA
>5LF1_1 Proteasome subunit alpha type-2 (chains A, O)
MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
Sequence of entity 2 (B, P), FASTA
>5LF1_2 Proteasome subunit alpha type-4 (chains B, P)
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK
Sequence of entity 3 (C, Q), FASTA
>5LF1_3 Proteasome subunit alpha type-7 (chains C, Q)
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
Sequence of entity 4 (D, R), FASTA
>5LF1_4 Proteasome subunit alpha type-5 (chains D, R)
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLME
PSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA
LQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSS
LQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
Sequence of entity 5 (E, S), FASTA
>5LF1_5 Proteasome subunit alpha type-1 (chains E, S)
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
ECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH
Sequence of entity 6 (F, T), FASTA
>5LF1_6 Proteasome subunit alpha type-3 (chains F, T)
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
Sequence of entity 7 (G, U), FASTA
>5LF1_7 Proteasome subunit alpha type-6 (chains G, U)
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
Sequence of entity 8 (H, V), FASTA
>5LF1_8 Proteasome subunit beta type-7 (chains H, V)
TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLIS
SNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTD
KLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISK
NKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
Sequence of entity 9 (I, W), FASTA
>5LF1_9 Proteasome subunit beta type-3 (chains I, W)
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAV
SGMGVIVHIIEKDKITTRTLKARMD
Sequence of entity 10 (J, X), FASTA
>5LF1_10 Proteasome subunit beta type-2 (chains J, X)
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
Sequence of entity 11 (K, Y), FASTA
>5LF1_11 Proteasome subunit beta type-5 (chains K, Y)
TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLA
RQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNR
ISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVR
EDGWIRVSSDNVADLHEKYSGSTP
Sequence of entity 12 (L, Z), FASTA
>5LF1_12 Proteasome subunit beta type-1 (chains L, Z)
RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGD
CLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGA
VYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFI
SAAERDVYTGDALRICIVTKEGIREETVSLRKD
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 10 |
| 6VC | ~{N}-[(2~{S})-1-[[(2~{S},3~{R},4~{S})-2,6-dimethyl-1,2,3-tris(oxidanyl)heptan-4… | C20 H40 N2 O6 | 6 |
Water and common crystallization additives (CL, K, 1PE) are not listed.
Primary citation
The inhibition mechanism of human 20S proteasomes enables next-generation inhibitor design. Schrader, J., Henneberg, F., Mata, R.A. et al. Science (2016) 353:594-598. DOI 10.1126/science.aaf8993 · PubMed
Other PDB entries of the same protein (UniProt P25787 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5LE5 1.8 Å, Native human 20S proteasome at 1.8 Angstrom
- 9TMN 1.85 Å, Human sperm 20S proteasome complex isolated from native source
- 5LEY 1.9 Å, Human 20S proteasome complex with Oprozomib at 1.9 Angstrom
- 5LF4 1.99 Å, Human 20S proteasome complex with Delanzomib at 2.0 Angstrom
- 5LF7 2.0 Å, Human 20S proteasome complex with Ixazomib at 2.0 Angstrom
- 8UD9 2.04 Å, Structure of human constitutive 20S proteasome complexed with the inhibitor TDI-8304
- 5LF6 2.07 Å, Human 20S proteasome complex with Z-LLY-ketoaldehyde at 2.1 Angstrom
- 5LF3 2.1 Å, Human 20S proteasome complex with Bortezomib at 2.1 Angstrom
- 8BZL 2.14 Å, Human 20S Proteasome in complex with peptide activator peptide BLM42
- 5LEZ 2.19 Å, Human 20S proteasome complex with Oprozomib in Mg-Acetate at 2.2 Angstrom
- 5LEX 2.2 Å, Native human 20S proteasome in Mg-Acetate at 2.2 Angstrom
- 7AWE 2.29 Å, HUMAN IMMUNOPROTEASOME 20S PARTICLE IN COMPLEX WITH [(1R)-2-(1-benzofuran-3-yl)-1-{[(1S,2…
Browse structure collections
About this viewer
MolViewer shows 5LF1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.