5LGP: Mouse CARM1

Name: PDB 5LGP: Crystal structure of mouse CARM1 in complex with ligand P1C3s
Published: 2017-03-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Crystal structure of mouse CARM1 in complex with ligand P1C3s. Determined by X-ray diffraction at 2.04 Å resolution. Released 22 Mar 2017.

Method: X-ray diffraction
Resolution: 2.04 Å
Organisms: Mus musculus, Homo sapiens
Chains: 8
Atoms: 12,224
Mol. weight: 170.41 kDa
Ligands: 8ZB
Released: 22 Mar 2017

Explore 5LGP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LGP contains 71 α-helices and 89 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	137-141	5
α-helix	144-154	11
α-helix	157-164	8
α-helix	167-178	12
α-helix	181-183	3
β-strand	188-192	5	1
α-helix	198-205	8
β-strand	210-215	6	1
α-helix	219-229	11
β-strand	236-240	5	1
β-strand	252-257	6	1
β-strand	261	1	2
β-strand	264	1	2
α-helix	269-275	7
α-helix	276-279	4
β-strand	280-287	8	1
β-strand	290-298	9	3
α-helix	301-311	11
α-helix	312-314	3
β-strand	319	1	4
β-strand	322	1	4
α-helix	325-327	3
α-helix	328-336	9
α-helix	339	1
β-strand	340-342	3	3
α-helix	346-348	3
β-strand	349	1	3
β-strand	351	1	5
α-helix	352-353	2
β-strand	354-359	6	3
α-helix	365-368	4
β-strand	370-378	9	6
β-strand	379	1	5
β-strand	383-397	15	3
β-strand	402-406	5	3
β-strand	418-429	12	3
β-strand	434-444	11	6
β-strand	448-457	10	6
β-strand	463-469	7	6
β-strand	474-475	2	3

Chain B: 17 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	137-141	5
α-helix	144-154	11
α-helix	157-164	8
α-helix	167-178	12
α-helix	181-183	3
β-strand	188-192	5	7
α-helix	198-205	8
β-strand	210-215	6	7
α-helix	219-229	11
β-strand	236-240	5	7
β-strand	252-257	6	7
β-strand	261	1	8
β-strand	264	1	8
α-helix	269-275	7
α-helix	276-279	4
β-strand	280-287	8	7
β-strand	290-298	9	9
α-helix	301-311	11
α-helix	312-315	4
β-strand	319	1	10
β-strand	322	1	10
α-helix	325-327	3
α-helix	328-336	9
α-helix	339	1
β-strand	340-342	3	9
α-helix	346-348	3
β-strand	349	1	9
α-helix	352-353	2
β-strand	354-359	6	9
α-helix	365-368	4
β-strand	370-378	9	11
β-strand	383-397	15	9
β-strand	402-406	5	9
β-strand	418-429	12	9
β-strand	434-444	11	11
β-strand	448-457	10	11
β-strand	462-469	8	11
β-strand	474-475	2	9

Chain C: 17 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	137-141	5
α-helix	144-153	10
α-helix	157-164	8
α-helix	167-179	13
α-helix	181-183	3
β-strand	188-192	5	12
α-helix	198-205	8
β-strand	210-215	6	12
α-helix	219-229	11
β-strand	236-240	5	12
α-helix	246-248	3
β-strand	252-257	6	12
β-strand	261	1	13
β-strand	264	1	13
α-helix	269-275	7
α-helix	276-279	4
β-strand	280-287	8	12
β-strand	290-298	9	14
α-helix	301-311	11
α-helix	312-314	3
β-strand	319	1	15
β-strand	322	1	15
α-helix	325-327	3
α-helix	328-336	9
β-strand	340-342	3	14
α-helix	346-348	3
β-strand	349	1	14
β-strand	351	1	16
α-helix	352-353	2
β-strand	354-359	6	14
α-helix	365-368	4
β-strand	370-378	9	17
β-strand	379	1	16
β-strand	383-397	15	14
β-strand	402-406	5	14
β-strand	418-429	12	14
β-strand	434-444	11	17
β-strand	448-457	10	17
β-strand	463-469	7	17
β-strand	474-475	2	14

Chain D: 16 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	137-140	4
α-helix	144-154	11
α-helix	157-164	8
α-helix	167-179	13
α-helix	181-183	3
β-strand	188-192	5	18
α-helix	198-205	8
β-strand	210-215	6	18
α-helix	219-229	11
β-strand	236-240	5	18
β-strand	252-257	6	18
β-strand	261	1	19
β-strand	264	1	19
α-helix	269-275	7
α-helix	276-279	4
β-strand	280-287	8	18
β-strand	290-298	9	20
α-helix	301-312	12
α-helix	313-315	3
β-strand	319	1	21
β-strand	322	1	21
α-helix	325-327	3
α-helix	328-336	9
β-strand	340-342	3	20
α-helix	346-348	3
β-strand	349	1	20
α-helix	352-353	2
β-strand	354-359	6	20
α-helix	365-368	4
β-strand	370-378	9	22
β-strand	383-397	15	20
β-strand	402-406	5	20
β-strand	418-429	12	20
β-strand	434-444	11	22
β-strand	448-457	10	22
β-strand	462-469	8	22
β-strand	474-475	2	20

Chain E: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	-5	1	3
α-helix	2-4	3

Chains F, G and H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-arginine methyltransferase CARM1	A, B, C, D	protein	361	Mus musculus	Q9WVG6 (AlphaFold model)
Polyadenylate-binding protein	E, F, G, H	protein	15	Homo sapiens	P11940 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5LGP_1 Histone-arginine methyltransferase CARM1 (chains A, B, C, D)
GHMGHTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKD
KIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEV
SLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYME
QFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEG
DLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSP
LFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPP
G

Sequence of entity 2 (E, F, G, H), FASTA

>5LGP_2 Polyadenylate-binding protein (chains E, F, G, H)
XFQNMPGAIRPAAPX

Ligands and cofactors

ID	Name	Formula	Copies
8ZB	(2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-propyl-oxolane-3,4-diol	C12 H17 N5 O3	4

Water and common crystallization additives (EDO) are not listed.

Primary citation

Transition state mimics are valuable mechanistic probes for structural studies with the arginine methyltransferase CARM1. van Haren, M.J., Marechal, N., Troffer-Charlier, N. et al. Proc Natl Acad Sci U S A (2017) 114:3625-3630. DOI 10.1073/pnas.1618401114 · PubMed

Other PDB entries of the same protein (UniProt Q9WVG6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IH3 1.77 Å, Crystal structure of mouse CARM1 in complex with SAH at 1.8 Angstroms resolution
5LV3 1.8 Å, Crystal structure of mouse CARM1 in complex with ligand LH1561Br
7QPH 1.9 Å, Crystal structure of mouse CARM1 in complex with histone H3_22-31 K27 acetylated
5K8X 1.99 Å, Crystal structure of mouse CARM1 in complex with inhibitor U3
5ISB 2.0 Å, Crystal structure of mouse CARM1 in complex with inhibitor SA0435
5LGR 2.0 Å, Crystal structure of mouse CARM1 in complex with ligand P1C3u
7QRD 2.0 Å, Crystal structure of mouse CARM1 in complex with histone H3_10-25
5IS6 2.01 Å, Crystal structure of mouse CARM1 in complex with Sinefungin at 2.0 Angstroms resolution
7PUQ 2.09 Å, CARM1 in complex with EML982
5ISE 2.1 Å, Crystal structure of mouse CARM1 in complex with inhibitor SA0649
5K8W 2.1 Å, Crystal structure of mouse CARM1 in complex with inhibitor U2
5LGS 2.1 Å, Crystal structure of mouse CARM1 in complex with ligand P2C3u

Browse structure collections

About this viewer

MolViewer shows 5LGP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.